PDB entry 3myk

View 3myk on RCSB PDB site
Description: Insights into the Importance of Hydrogen Bonding in the Gamma-Phosphate Binding Pocket of Myosin: Structural and Functional Studies of Ser236
Deposited on 2010-05-10, released 2010-05-26
The last revision was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.195
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: myosin-2 heavy chain
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: DDB_G0286355, mhcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (1-End)
      • engineered mutation (235)
  • Heterogens: BIT, MG, ANP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'X':
    Sequence, based on SEQRES records:
    >3mykX (X:)
    gnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnasrfg
    kfieiqfnsagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqyrfgitkiffragqlarieearelpn
    

    Sequence, based on observed residues (ATOM records):
    >3mykX (X:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrnsgvleqqilqanpileafgnakttrnnnasrfgkfiei
    qfnsagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfn
    ylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgage
    gavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkal
    ygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhh
    mfkleqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdntlit
    klhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssd
    nvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnkqlpa
    kledkvvldqlrcngvlegiritrkgfpnriiqyrfgitkiffrag