PDB entry 3myi

View 3myi on RCSB PDB site
Description: Human metavinculin tail domain
Class: cell adhesion
Keywords: cytoskeleton, focal adhesions, cell adhesion, muscle tissue development, cardiomyopathy
Deposited on 2010-05-10, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.193
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vinculin
    Species: Homo sapiens [TaxId:9606]
    Gene: VCL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3myia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3myiA (A:)
    nqpvnqpilaaaqslhreatkwsskgndiiaaakrmallmaemsrlvrggsgtkraliqc
    akdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlgrtn
    isdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3myiA (A:)
    pvnqpilaaaqslhreatkwsskgndiiaaakrmallmaemsrlvrggsgtkraliqcak
    diakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlgrtnis
    deeseqatemlvhnaqnlmqsvketvreaeaasikitlrwvrk