PDB entry 3myg

View 3myg on RCSB PDB site
Description: Aurora A Kinase complexed with SCH 1473759
Class: transferase
Keywords: Kinase, Cell Cycle, Inhibitor, TRANSFERASE
Deposited on 2010-05-10, released 2010-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.222
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3myga_
  • Heterogens: PG4, EML, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mygA (A:)
    gamgskrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlr
    reveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyite
    lanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppe
    miegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardl
    isrllkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mygA (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhtldylppemiegrmhdekvdlwslg
    vlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlre
    vlehpwitanss