PDB entry 3myf

View 3myf on RCSB PDB site
Description: the crystal structure of the hpt domain from the hpt sensor hybrid histidine kinase from shewanella to 1.80a
Deposited on 2010-05-10, released 2010-05-26
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein
    Species: Shewanella sp. W3-18-1 [TaxId:351745]
    Gene: Sputw3181_1245
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Sensor protein
    Species: Shewanella sp. W3-18-1 [TaxId:351745]
    Gene: Sputw3181_1245
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Sensor protein
    Species: Shewanella sp. W3-18-1 [TaxId:351745]
    Gene: Sputw3181_1245
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Sensor protein
    Species: Shewanella sp. W3-18-1 [TaxId:351745]
    Gene: Sputw3181_1245
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3myfA (A:)
    fdlhtlnwdlcltqanhksnlalemlkmlldslpetvekiqtalgqndqatmlstihklh
    gascycgvpttqrlcqeiesalkrqtpvedlepeilelldeltkvesavkqvlsqlsae
    

    Sequence, based on observed residues (ATOM records):
    >3myfA (A:)
    dlhtlnwdlcltqanhksnlalemlkmlldslpetvekiqtalgqndqatmlstihklhg
    ascycgvpttqrlcqeiesalkrqtpvedlepeilelldeltkvesavkqvlsqlsa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3myfB (B:)
    fdlhtlnwdlcltqanhksnlalemlkmlldslpetvekiqtalgqndqatmlstihklh
    gascycgvpttqrlcqeiesalkrqtpvedlepeilelldeltkvesavkqvlsqlsae
    

    Sequence, based on observed residues (ATOM records):
    >3myfB (B:)
    dlhtlnwdlcltqanhksnlalemlkmlldslpetvekiqtalgqndqatmlstihklhg
    ascycgvpttqrlcqeiesalkrqtpvedlepeilelldeltkvesavkqvlsq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3myfC (C:)
    fdlhtlnwdlcltqanhksnlalemlkmlldslpetvekiqtalgqndqatmlstihklh
    gascycgvpttqrlcqeiesalkrqtpvedlepeilelldeltkvesavkqvlsqlsae
    

    Sequence, based on observed residues (ATOM records):
    >3myfC (C:)
    dlhtlnwdlcltqanhksnlalemlkmlldslpetvekiqtalgqndqatmlstihklhg
    ascycgvpttqrlcqeiesalkrqtpvedlepeilelldeltkvesavkqvlsq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3myfD (D:)
    fdlhtlnwdlcltqanhksnlalemlkmlldslpetvekiqtalgqndqatmlstihklh
    gascycgvpttqrlcqeiesalkrqtpvedlepeilelldeltkvesavkqvlsqlsae
    

    Sequence, based on observed residues (ATOM records):
    >3myfD (D:)
    dlhtlnwdlcltqanhksnlalemlkmlldslpetvekiqtalgqndqatmlstihklhg
    ascycgvpttqrlcqeiesalkrqtpvedlepeilelldeltkvesavkqvlsqls