PDB entry 3mye

View 3mye on RCSB PDB site
Description: Crystal Structure of HP67 L61GL
Class: structural protein
Keywords: Villin Headpiece, protein, helix, hydrophobic, STRUCTURAL PROTEIN
Deposited on 2010-05-10, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Villin-1
    Species: Gallus gallus [TaxId:9031]
    Gene: VIL1, VIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02640 (Start-67)
      • insertion (51)
    Domains in SCOPe 2.07: d3myex_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3myeX (X:)
    ptkletfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanglplwkqqn
    lkkekglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3myeX (X:)
    etfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanglplwkqqnlkke
    kglf