PDB entry 3myd

View 3myd on RCSB PDB site
Description: structure of the cytoplasmic domain of flha from helicobacter pylori
Deposited on 2010-05-10, released 2010-05-26
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar biosynthesis protein flhA
    Species: Helicobacter pylori [TaxId:210]
    Gene: flbA, flhA, HP1041, jhp_0383
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mydA (A:)
    gplgstraktqeeikreeeqaidevlkieflelalgyqlisladmkqggdllerirgirk
    kiasdygflmpqirirdnlqlppthyeiklkgivigegmvmpdkflamntgfvnreiegi
    ptkepafgmdalwidaknkeeaiiqgytiidpstviathtselvkkyaedfitkdevksl
    lerlakdyptiveeskkiptgairsvlqallhekipikdmltiletitdiaplvqndvni
    lteqvrarlsrvitnafksedgrlkfltfstdseqfllnklrengtskslllnvgelqkl
    iegvseeamkvlqkgiapvilivepnlrkalsnqmeqaridvvvlshaeldpnsnfealg
    tihin
    

    Sequence, based on observed residues (ATOM records):
    >3mydA (A:)
    eeqaidevlkieflelalgyqlisladmkqggdllerirgirkkiasdygflmpqirird
    nlqlppthyeiklkgivigegmvmpdkflamntgfvnreiegiptkepafgmdalwidak
    nkeeaiiqgytiidpstviathtselvkkyaedfitkdevksllerlakdyptiveeskk
    iptgairsvlqallhekipikdmltiletitdiaplvqndvnilteqvrarlsrvitnaf
    ksedgrlkfltfstdseqfllnklrengtskslllnvgelqkliegvseeamkvlqkgia
    pvilivepnlrkalsnqmeqaridvvvlshaeldpnsnfealgtihin