PDB entry 3myb

View 3myb on RCSB PDB site
Description: Crystal structure of enoyl-coa hydratase mycobacterium smegmatis
Class: lyase
Keywords: SSGCID, ENOYL-COA HYDRATASE, MYCOBACTERIUM SMEGMATIS, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, LYASE
Deposited on 2010-05-10, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-coa hydratase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_1594
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3myba_
  • Chain 'B':
    Compound: enoyl-coa hydratase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_1594
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mybb_
  • Chain 'C':
    Compound: enoyl-coa hydratase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_1594
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mybc_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mybA (A:)
    mahhhhhhmgtleaqtqgpgsmseplllqdrdergvvtltlnrpqafnalseamlaalge
    afgtlaedesvravvlaasgkafcaghdlkemraepsreyyeklfarctdvmlaiqrlpa
    pviarvhgiataagcqlvamcdlavatrdarfavsginvglfcstpgvalsrnvgrkaaf
    emlvtgefvsaddakglglvnrvvapkalddeieamvskivakpraavamgkalfyrqie
    tdiesayadagttmacnmmdpsalegvsaflekrrpewhtpqpsta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mybA (A:)
    eplllqdrdergvvtltlnrpqafnalseamlaalgeafgtlaedesvravvlaasgkaf
    caghdlkemraepsreyyeklfarctdvmlaiqrlpapviarvhgiataagcqlvamcdl
    avatrdarfavsginvglfcstpgvalsrnvgrkaafemlvtgefvsaddakglglvnrv
    vapkalddeieamvskivakpraavamgkalfyrqietdiesayadagttmacnmmdpsa
    legvsaflekrrpewhtpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mybB (B:)
    mahhhhhhmgtleaqtqgpgsmseplllqdrdergvvtltlnrpqafnalseamlaalge
    afgtlaedesvravvlaasgkafcaghdlkemraepsreyyeklfarctdvmlaiqrlpa
    pviarvhgiataagcqlvamcdlavatrdarfavsginvglfcstpgvalsrnvgrkaaf
    emlvtgefvsaddakglglvnrvvapkalddeieamvskivakpraavamgkalfyrqie
    tdiesayadagttmacnmmdpsalegvsaflekrrpewhtpqpsta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mybB (B:)
    eplllqdrdergvvtltlnrpqafnalseamlaalgeafgtlaedesvravvlaasgkaf
    caghdlkemraepsreyyeklfarctdvmlaiqrlpapviarvhgiataagcqlvamcdl
    avatrdarfavsginvglfcstpgvalsrnvgrkaafemlvtgefvsaddakglglvnrv
    vapkalddeieamvskivakpraavamgkalfyrqietdiesayadagttmacnmmdpsa
    legvsaflekrrpewht
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mybC (C:)
    mahhhhhhmgtleaqtqgpgsmseplllqdrdergvvtltlnrpqafnalseamlaalge
    afgtlaedesvravvlaasgkafcaghdlkemraepsreyyeklfarctdvmlaiqrlpa
    pviarvhgiataagcqlvamcdlavatrdarfavsginvglfcstpgvalsrnvgrkaaf
    emlvtgefvsaddakglglvnrvvapkalddeieamvskivakpraavamgkalfyrqie
    tdiesayadagttmacnmmdpsalegvsaflekrrpewhtpqpsta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mybC (C:)
    eplllqdrdergvvtltlnrpqafnalseamlaalgeafgtlaedesvravvlaasgkaf
    caghdlkemraepsreyyeklfarctdvmlaiqrlpapviarvhgiataagcqlvamcdl
    avatrdarfavsginvglfcstpgvalsrnvgrkaafemlvtgefvsaddakglglvnrv
    vapkalddeieamvskivakpraavamgkalfyrqietdiesayadagttmacnmmdpsa
    legvsaflekrrpewhtpq