PDB entry 3mya

View 3mya on RCSB PDB site
Description: Crystal Structure of HP67 H41F - P61
Class: structural protein
Keywords: villin headpiece, alpha helix, protein, STRUCTURAL PROTEIN
Deposited on 2010-05-10, released 2011-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Villin-1
    Species: Gallus gallus [TaxId:9031]
    Gene: VIL, VIL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02640 (0-66)
      • engineered mutation (31)
    Domains in SCOPe 2.08: d3myaa_
  • Chain 'B':
    Compound: Villin-1
    Species: Gallus gallus [TaxId:9031]
    Gene: VIL, VIL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02640 (Start-66)
      • engineered mutation (31)
    Domains in SCOPe 2.08: d3myab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3myaA (A:)
ptkletfpldvlvntaaedlprgvdpsrkenflsdedfkavfgmtrsafanlplwkqqnl
kkekglf

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3myaB (B:)
ptkletfpldvlvntaaedlprgvdpsrkenflsdedfkavfgmtrsafanlplwkqqnl
kkekglf

    Sequence, based on observed residues (ATOM records): (download) 
    >3myaB (B:)
letfpldvlvntaaedlprgvdpsrkenflsdedfkavfgmtrsafanlplwkqqnlkke
kglf