PDB entry 3my9

View 3my9 on RCSB PDB site
Description: Crystal structure of a muconate cycloisomerase from Azorhizobium caulinodans
Class: isomerase
Keywords: STRUCTURAL GENOMICS, ISOMERASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2010-05-10, released 2010-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Azorhizobium caulinodans [TaxId:438753]
    Gene: AZC_0819
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3my9a1, d3my9a2
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3my9A (A:)
    slswdsvveririflvespikmarlqgvgnvkgsvkrvllevtsadgivgwgeaapwevf
    tgtpeaafsaldiylrplilgapikrvrelmarmdkmlvghgeakaavemalldilgkat
    glsvadllggrvrdriplsfsiadpdfdadlermramvpaghtvfkmktgvkphaeelri
    letmrgefgeridlrldfnqaltpfgamkilrdvdafrptfieqpvprrhldamagfaaa
    ldtpiladescfdavdlmevvrrqaadaisvkimkcgglmkaqslmaiadtaglpgyggt
    lweggialaagtqliaatpgislgcefymphhvltedvleeriansaghvivpdgpglgi
    siseaslrgnakilaer
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my9A (A:)
    swdsvveririflvespikmgsvkrvllevtsadgivgwgeaapwtpeaafsaldiylrp
    lilgapikrvrelmarmdkmlvghgeakaavemalldilgkatglsvadllggrvrdrip
    lsfsiadpdfdadlermramvpaghtvfkmktgvkphaeelriletmrgefgeridlrld
    fnqaltpfgamkilrdvdafrptfieqpvprrhldamagfaaaldtpiladescfdavdl
    mevvrrqaadaisvkimkcgglmkaqslmaiadtaglpgyggtlweggialaagtqliaa
    tpgislgcefymphhvltedvleeriansaghvivpdgpglgisiseaslrgnakil