PDB entry 3my2

View 3my2 on RCSB PDB site
Description: Crystal structure of LptC
Deposited on 2010-05-09, released 2010-09-01
The last revision was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipopolysaccharide export system protein lptC
    Species: Escherichia coli [TaxId:511145]
    Gene: b3199, JW3166, lptC, yrbK
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3my2A (A:)
    hhhhhhnmaekddtaqvvvnnndptyksehtdtlvynpegalsyrliaqhveyysdqavs
    wftqpvlttfdkdkiptwsvkadkakltndrmlylyghvevnalvpdsqlrrittdnaqi
    nlvtqdvtsedlvtlygttfnssglkmrgnlrsknaeliekvrtsyeiqnkqtqp
    

    Sequence, based on observed residues (ATOM records):
    >3my2A (A:)
    syrliaqhveyysdqavswftqpvlttfdkdkiptwsvkadkakltndrmlylyghvevn
    alvpdsqlrrittdnaqinlvtqdvtsedlvtlygttfnssglkmrgnlrsknaeliekv
    rtsyei