PDB entry 3my1

View 3my1 on RCSB PDB site
Description: Structure of CDK9/cyclinT1 in complex with DRB
Class: transcription/protein binding/inhibitor
Keywords: CDK-cyclin complex, phosphorylated, TRANSCRIPTION-PROTEIN BINDING-INHIBITOR complex
Deposited on 2010-05-09, released 2010-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.175
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC2L4, CDK9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3my1a_
  • Chain 'B':
    Compound: Cyclin-T1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60563 (Start-259)
      • engineered mutation (77)
      • engineered mutation (96)
      • engineered mutation (241)
    Domains in SCOPe 2.07: d3my1b1, d3my1b2
  • Heterogens: PO4, GOL, RFZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3my1A (A:)
    gpakqydsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegf
    pitalreikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlv
    kftlseikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslakn
    sqpnrytnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqla
    lisqlcgsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvld
    paqridsddalnhdffwsdpmpsdlkgmlst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my1A (A:)
    dsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalr
    eikilqllkhenvvnlieicrtkkgsiylvfdfcehdlagllsnvlvkftlseikrvmqm
    llnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytnrvvtl
    wyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpev
    wpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnh
    dffwsdpmpsdlkgm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3my1B (B:)
    gpegerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqlti
    ntaivymhrfymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslp
    dtrseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmat
    nslhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelth
    ellqilektpnrlkriwnwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my1B (B:)
    nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh
    rfymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslpdtrseayl
    qqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhlttf
    slqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthellqilek
    tpnrlkriwnwr