PDB entry 3my0

View 3my0 on RCSB PDB site
Description: Crystal structure of the ACVRL1 (ALK1) kinase domain bound to LDN-193189
Class: transferase
Keywords: Protein Kinase, Serine/threonine-protein kinase receptor, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2010-05-08, released 2010-07-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.209
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0a_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3my0b_
  • Chain 'C':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0c_
  • Chain 'D':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0d_
  • Chain 'E':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0e_
  • Chain 'F':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0f_
  • Chain 'G':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0g_
  • Chain 'H':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0h_
  • Chain 'I':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0i_
  • Chain 'J':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3my0j_
  • Chain 'K':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3my0k_
  • Chain 'L':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0l_
  • Chain 'M':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0m_
  • Chain 'N':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0n_
  • Chain 'O':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0o_
  • Chain 'P':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3my0p_
  • Chain 'Q':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0q_
  • Chain 'R':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0r_
  • Chain 'S':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0s_
  • Chain 'T':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0t_
  • Chain 'U':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0u_
  • Chain 'V':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0v_
  • Chain 'W':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37023 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3my0w_
  • Chain 'X':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRL1 (ALK1), ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3my0x_
  • Heterogens: LDN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3my0A (A:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0A (A:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtstqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhvei
    fgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkryma
    pevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfed
    mkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3my0B (B:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0B (B:)
    qrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrhd
    nilgfiasdmttqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveifg
    tqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymape
    vldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedmk
    kvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkisn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3my0C (C:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0C (C:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglahl
    hveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtk
    rymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndp
    sfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3my0D (D:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0D (D:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglahl
    hveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtk
    rymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndp
    sfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3my0E (E:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0E (E:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveifg
    tqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymape
    vldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedmk
    kvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3my0F (F:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0F (F:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveifg
    tqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymape
    vldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedmk
    kvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3my0G (G:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0G (G:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveifg
    tqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymape
    vldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedmk
    kvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3my0H (H:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0H (H:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtsqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveif
    gtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymap
    evldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedm
    kkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3my0I (I:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0I (I:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveifgt
    qgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymapev
    ldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedmkk
    vvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3my0J (J:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0J (J:)
    rqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrhdnilgf
    iasdmqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhvepaiahrdfks
    rnvlvksnlqcciadlglavrymapevldeqirtdcfesykwtdiwafglvlweiarrti
    vvedyrppfydvvpedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarlt
    alrikktlqkis
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3my0K (K:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0K (K:)
    qrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrhd
    nilgfiasdmttqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveikp
    aiahrdfksrnvlvksnlqcciadlglavdignnprvgtkrymapevldeqirtdcfesy
    kwtdiwafglvlweiarrtivedyrppfydvvpndpsfedmkkvvcvdqqtplaqmmrec
    wypnpsarltalrikktlqki
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3my0L (L:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0L (L:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtstqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhvei
    fgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkryma
    pevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfed
    mkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3my0M (M:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0M (M:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtsrtqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhve
    ifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrym
    apevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfe
    dmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkisn
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3my0N (N:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0N (N:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglahl
    hveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtk
    rymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndp
    sfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3my0O (O:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0O (O:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglahl
    hveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtk
    rymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndp
    sfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlq
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3my0P (P:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0P (P:)
    qrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrhd
    nilgfiasdmqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveitqgk
    paiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymapevlde
    qirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedmkkvvc
    vdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3my0Q (Q:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0Q (Q:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveifg
    tqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymape
    vldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedmk
    kvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3my0R (R:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0R (R:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveifg
    tqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymape
    vldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedmk
    kvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3my0S (S:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0S (S:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtsqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveif
    gtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymap
    evldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedm
    kkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3my0T (T:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0T (T:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveifgt
    qgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymapev
    ldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedmkk
    vvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3my0U (U:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0U (U:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmttqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhvepa
    iahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymapevldeqi
    rtdcfesykwtdiwafglvlweiarrtivvedyrppfydvvpndpsfedmkkvvcvdqqt
    ptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3my0V (V:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0V (V:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmttqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveik
    paiahrdfksrnvlvksnlqcciadlglavmdignnprvgtkrymapevldeqirtdcfe
    sykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedmkkvvcvdqqtpti
    pnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3my0W (W:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0W (W:)
    mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
    dnilgfiasdmtqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveikp
    aiahrdfksrnvlvksnlqcciadlglavmdignnprvgtkrymapevldeqirtdcfes
    ykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedmkkvvcvdqqtptip
    nrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3my0X (X:)
    smqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllr
    hdnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglah
    lhveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgt
    krymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpnd
    psfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqki
    snspe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3my0X (X:)
    qrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrhd
    nilgfiasdmtlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveikpai
    ahrdfksrnvlvksnlqcciadlglavmnnprvgtkrymapevldeqirtdcfesykwtd
    iwafglvlweiarredyrppfydvvpndpsfedmkkvvcvdqqtptipnrlalaqmmrec
    wypnpsarltalrikkt