PDB entry 3mxz

View 3mxz on RCSB PDB site
Description: crystal structure of tubulin folding cofactor a from arabidopsis thaliana
Deposited on 2010-05-08, released 2010-09-01
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tubulin-specific chaperone a
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: KIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04350 (3-End)
      • expression tag (2)
  • Heterogens: NO3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mxzA (A:)
    gshmatirnlkiktstckrivkelhsyekevereaaktadmkdkgadpydlkqqenvlge
    srmmipdchkrlesaladlkstlaeleetdekegpeiedakktvadvekqfpteda
    

    Sequence, based on observed residues (ATOM records):
    >3mxzA (A:)
    hmatirnlkiktstckrivkelhsyekevereaaktadmkdkgadpydlkqqenvlgesr
    mmipdchkrlesaladlkstlaeleetekegpeiedakktvadvekq