PDB entry 3mxy

View 3mxy on RCSB PDB site
Description: Structures of Grb2-SH2 Domain and AICD peptide Complexes Reveal a Conformational Switch and Their Functional Implications.
Class: protein binding
Keywords: Protein-peptide complex, AICD, Grb2-SH2, PROTEIN BINDING, ALZHEIMER'S DISEASE, APP
Deposited on 2010-05-08, released 2011-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.232
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62993 (3-100)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d3mxya1, d3mxya2
  • Chain 'L':
    Compound: AICD peptide E683V variant
    Database cross-references and differences (RAF-indexed):
    • PDB 3MXY (Start-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mxyA (A:)
    gshmkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvl
    rdgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'L':
    No sequence available.