PDB entry 3mxw

View 3mxw on RCSB PDB site
Description: Crystal structure Sonic hedgehog bound to the 5E1 fab fragment
Class: signaling protein
Keywords: antibody complex, fab fragment, metalloprotease, calcium binding, zinc hydrolase, development, morphogen, SIGNALING PROTEIN
Deposited on 2010-05-07, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.181
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sonic hedgehog protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SHH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mxwa_
  • Chain 'H':
    Compound: 5E1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MXW (0-219)
  • Chain 'L':
    Compound: 5E1 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MXW (0-End)
    Domains in SCOPe 2.07: d3mxwl1, d3mxwl2
  • Heterogens: ZN, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mxwA (A:)
    gfgkrrhpkkltplaykqfipnvaektlgasgryegkisrnserfkeltpnynpdiifkd
    eentgadrlmtqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdi
    ttsdrdrskygmlarlaveagfdwvyyeskahihcsvkaensvaaksgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mxwA (A:)
    ltplaykqfipnvaektlgasgryegkisrnserfkeltpnynpdiifkdeentgadrlm
    tqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsky
    gmlarlaveagfdwvyyeskahihcsvkaensv
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3mxwL (L:)
    divmtqtpkfllvsagdkvtitckasqsvsndltwyqqkpgqspklliyyasnrytgvpd
    rftgsgygtdftftistvqaedlavyfcqqdygspptfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mxwL (L:)
    divmtqtpkfllvsagdkvtitckasqsvsndltwyqqkpgqspklliyyasnrytgvpd
    rftgsgygtdftftistvqaedlavyfcqqdygspptfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg