PDB entry 3mxv

View 3mxv on RCSB PDB site
Description: Crystal structure of fab fragment of anti-Shh 5E1 chimera
Class: immune system
Keywords: chimera, fab fragment, antibody, sonic hedgehog, IMMUNE SYSTEM
Deposited on 2010-05-07, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab fragment of anti-Shh 5E1 mouse/human chimera, heavy chain
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MXV (0-End)
  • Chain 'L':
    Compound: fab fragment of anti-Shh 5E1 mouse/human chimera, light chain
    Species: MUS MUSCULUS, HOMO SAPIENS [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MXV (0-End)
    Domains in SCOPe 2.07: d3mxvl1, d3mxvl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3mxvL (L:)
    divmtqtpkfllvsagdkvtitckasqsvsndltwyqqkpgqspklliyyasnrytgvpd
    rftgsgygtdftftistvqaedlavyfcqqdygspptfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mxvL (L:)
    divmtqtpkfllvsagdkvtitckasqsvsndltwyqqkpgqspklliyyasnrytgvpd
    rftgsgygtdftftistvqaedlavyfcqqdygspptfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg