PDB entry 3mxu

View 3mxu on RCSB PDB site
Description: Crystal structure of glycine cleavage system protein H from Bartonella henselae
Class: oxidoreductase
Keywords: Seattle Structural Genomics Center for Infectious Disease, SSGCID, Cat-scratch disease, bacteremia, lymphadenopathy, endocarditis, HIV co-infection, OXIDOREDUCTASE
Deposited on 2010-05-07, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine cleavage system H protein
    Species: Bartonella henselae [TaxId:38323]
    Gene: gcvH, BH12830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6G2F0 (21-End)
      • expression tag (8-20)
    Domains in SCOPe 2.07: d3mxua1, d3mxua2
  • Heterogens: CIT, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mxuA (A:)
    mahhhhhhmgtleaqtqgpgsmsktyftqdhewlsvegqvvtvgitdyaqeqlgdlvfid
    lpqngtklskgdaaavvesvkaasdvyapldgevveinaalaespelvnqkaetegwlwk
    mtvqdetqlerlldeaaykelig
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mxuA (A:)
    mgtleaqtqgpgsmsktyftqdhewlsvegqvvtvgitdyaqeqlgdlvfidlpqngtkl
    skgdaaavvesvkaasdvyapldgevveinaalaespelvnqkaetegwlwkmtvqdetq
    lerlldeaaykeli