PDB entry 3mxq

View 3mxq on RCSB PDB site
Description: crystal structure of sensory box sensor histidine kinase from vibrio cholerae
Deposited on 2010-05-07, released 2010-05-26
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1084
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KT21 (16-End)
      • expression tag (11-15)
  • Chain 'B':
    Compound: Sensor protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1084
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KT21 (16-End)
      • expression tag (7-15)
  • Chain 'C':
    Compound: Sensor protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1084
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KT21 (16-End)
      • expression tag (11-15)
  • Chain 'D':
    Compound: Sensor protein
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_1084
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KT21 (16-End)
      • expression tag (9-15)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mxqA (A:)
    mhhhhhhenlyfqsnamaksrlllselldqlsfalcivrndyvivkvneyfesrvifdge
    tmqgknilelfpesadylkrkidtalviesssfssweqkphllpfkssrpvsgeeeqmyq
    nlevipihsedgtiehvclcvydvtiqasqqq
    

    Sequence, based on observed residues (ATOM records):
    >3mxqA (A:)
    fqsnamaksrlllselldqlsfalcivrndyvivkvneyfesrvifdgetmqgknilelf
    pesadylkrkidtalviesssfssweqkphllpfeqmyqnlevipihsedgtiehvclcv
    ydvtiq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mxqB (B:)
    mhhhhhhenlyfqsnamaksrlllselldqlsfalcivrndyvivkvneyfesrvifdge
    tmqgknilelfpesadylkrkidtalviesssfssweqkphllpfkssrpvsgeeeqmyq
    nlevipihsedgtiehvclcvydvtiqasqqq
    

    Sequence, based on observed residues (ATOM records):
    >3mxqB (B:)
    enlyfqsnamaksrlllselldqlsfalcivrndyvivkvneyfesrvimqgknilelfp
    esadylkrkidtalviesssfsseqkpllpqmyqnlevipihsedgtiehvclcvydvt
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mxqC (C:)
    mhhhhhhenlyfqsnamaksrlllselldqlsfalcivrndyvivkvneyfesrvifdge
    tmqgknilelfpesadylkrkidtalviesssfssweqkphllpfkssrpvsgeeeqmyq
    nlevipihsedgtiehvclcvydvtiqasqqq
    

    Sequence, based on observed residues (ATOM records):
    >3mxqC (C:)
    fqsnamaksrlllselldqlsfalcivrndyvivkvneyfesrvifdgetmqgknilelf
    pesadylkrkidtalviesssfssweqkphllpfkqmyqnlevipihsedgtiehvclcv
    ydvti
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mxqD (D:)
    mhhhhhhenlyfqsnamaksrlllselldqlsfalcivrndyvivkvneyfesrvifdge
    tmqgknilelfpesadylkrkidtalviesssfssweqkphllpfkssrpvsgeeeqmyq
    nlevipihsedgtiehvclcvydvtiqasqqq
    

    Sequence, based on observed residues (ATOM records):
    >3mxqD (D:)
    lyfqsnamaksrlllselldqlsfalcivrndyvivkvneyfesrvigetmqgknilelf
    pesadylkrkidtalviesssfsseqkphlmyqnlevipihsedgtiehvclcvydv