PDB entry 3mxo

View 3mxo on RCSB PDB site
Description: crystal structure oh human phosphoglycerate mutase family member 5 (pgam5)
Deposited on 2010-05-07, released 2010-09-15
The last revision was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase PGAM5, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96HS1 (2-201)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Serine/threonine-protein phosphatase PGAM5, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96HS1 (2-201)
      • expression tag (0-1)
  • Heterogens: EDO, PG4, CL, PGE, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mxoA (A:)
    smdhykakatrhiflirhsqyhvdgslekdrtltplgreqaeltglrlaslglkfnkivh
    ssmtraiettdiisrhlpgvckvstdllregapiepdppvshwkpeavqyyedgarieaa
    frnyihradarqeedsyeifichanviryivcralqfppegwlrlslnngsithlvirpn
    grvalrtlgdtgfmppdkitrs
    

    Sequence, based on observed residues (ATOM records):
    >3mxoA (A:)
    smdhykakatrhiflirhsqyhvdgslekdrtltplgreqaeltglrlaslglkfnkivh
    ssmtraiettdiisrhlpgvckvstdllregapvqyyedgarieaafrnyihradarqee
    dsyeifichanviryivcralqfppegwlrlslnngsithlvirpngrvalrtlgdtgfm
    ppdkitrs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mxoB (B:)
    smdhykakatrhiflirhsqyhvdgslekdrtltplgreqaeltglrlaslglkfnkivh
    ssmtraiettdiisrhlpgvckvstdllregapiepdppvshwkpeavqyyedgarieaa
    frnyihradarqeedsyeifichanviryivcralqfppegwlrlslnngsithlvirpn
    grvalrtlgdtgfmppdkitrs
    

    Sequence, based on observed residues (ATOM records):
    >3mxoB (B:)
    smdhykakatrhiflirhsqyhvdgslekdrtltplgreqaeltglrlaslglkfnkivh
    ssmtraiettdiisrhlpgvckvstdllregakpeavqyyedgarieaafrnyihradar
    qeedsyeifichanviryivcralqfppegwlrlslnngsithlvirpngrvalrtlgdt
    gfmppdkitrs