PDB entry 3mxm

View 3mxm on RCSB PDB site
Description: TREX1 3' Exonuclease V201D Aicardi-Goutieres Syndrome Mutant
Class: hydrolase/DNA
Keywords: RNase H-like fold, Polyproline type II helix, HYDROLASE-DNA complex
Deposited on 2010-05-07, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.173
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Three prime repair exonuclease 1
    Species: Mus musculus [TaxId:10090]
    Gene: Trex1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91XB0
      • engineered mutation (200)
    Domains in SCOPe 2.07: d3mxma_
  • Chain 'B':
    Compound: Three prime repair exonuclease 1
    Species: Mus musculus [TaxId:10090]
    Gene: Trex1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91XB0
      • engineered mutation (200)
    Domains in SCOPe 2.07: d3mxmb_
  • Chain 'C':
    Compound: DNA (5'-d(*gp*ap*cp*g)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*gp*ap*cp*g)-3')
  • Heterogens: CA, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mxmA (A:)
    mgsqtlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprp
    prvvdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcc
    lvahngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslg
    siytrlywqaptdshtaegddltllsicqwkpqallqwvdeharpfstvkpmygtpattg
    tt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mxmA (A:)
    lphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvd
    klslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahn
    gdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspgsrksyslgsiytrlyw
    qaptdshtaegddltllsicqwkpqallqwvdeharpfstvkpmyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mxmB (B:)
    mgsqtlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprp
    prvvdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcc
    lvahngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslg
    siytrlywqaptdshtaegddltllsicqwkpqallqwvdeharpfstvkpmygtpattg
    tt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mxmB (B:)
    lphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvd
    klslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahn
    gdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspksyslgsiytrlywqap
    tdshtaegddltllsicqwkpqallqwvdeharpfstvkpmyg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.