PDB entry 3mxh

View 3mxh on RCSB PDB site
Description: Native structure of a c-di-GMP riboswitch from V. cholerae
Class: RNA binding protein/RNA
Keywords: RNA, riboswitch, c-di-GMP, RNA BINDING PROTEIN-RNA complex
Deposited on 2010-05-07, released 2010-08-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered mutation (30)
      • engineered mutation (35)
    Domains in SCOPe 2.06: d3mxhp_
  • Chain 'R':
    Compound: c-di-GMP Riboswitch
    Species: synthetic, synthetic
  • Heterogens: MG, C2E, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download) 
    >3mxhP (P:)
mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk

    Sequence, based on observed residues (ATOM records): (download) 
    >3mxhP (P:)
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdi

  • Chain 'R':
    No sequence available.