PDB entry 3mxe

View 3mxe on RCSB PDB site
Description: Crystal structure of HIV-1 protease inhibitor, KC32 complexed with wild-type protease
Class: hydrolase/hydrolase inhibitor
Keywords: drug design, protease inhibitors, HIV protease, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-05-07, released 2010-11-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (63)
    Domains in SCOPe 2.04: d3mxea_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (63)
    Domains in SCOPe 2.04: d3mxeb_
  • Heterogens: K54, PO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mxeA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mxeB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf