PDB entry 3mxe
View 3mxe on RCSB PDB site
Description: Crystal structure of HIV-1 protease inhibitor, KC32 complexed with wild-type protease
Class: hydrolase/hydrolase inhibitor
Keywords: drug design, protease inhibitors, HIV protease, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2010-05-07, released
2010-11-10
The last revision prior to the SCOPe 2.04 freeze date was dated
2013-02-20, with a file datestamp of
2013-02-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.182
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered mutation (6)
- engineered mutation (63)
Domains in SCOPe 2.04: d3mxea_ - Chain 'B':
Compound: hiv-1 protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered mutation (6)
- engineered mutation (63)
Domains in SCOPe 2.04: d3mxeb_ - Heterogens: K54, PO4, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3mxeA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3mxeB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf