PDB entry 3mxd

View 3mxd on RCSB PDB site
Description: Crystal structure of HIV-1 protease inhibitor KC53 in complex with wild-type protease
Class: hydrolase/hydrolase inhibitor
Keywords: drug design, HIV-1 protease, protease inhibitors, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-05-07, released 2010-11-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.167
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (63)
  Domains in SCOPe 2.02: d3mxda_
• Chain 'B':
  Compound: hiv-1 protease
  Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (63)
  Domains in SCOPe 2.02: d3mxdb_
• Heterogens: K53, PO4, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mxdA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mxdB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf