PDB entry 3mxc

View 3mxc on RCSB PDB site
Description: Structures of Grb2-SH2 Domain and AICD peptide Complexes Reveal a Conformational Switch and Their Functional Implications.
Class: protein binding
Keywords: Protein-peptide complex, AICD, Grb2-SH2, PROTEIN BINDING, ALZHEIMER'S DISEASE, APP
Deposited on 2010-05-07, released 2011-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3mxca_
  • Chain 'L':
    Compound: AICD peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3MXC (Start-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3mxcA (A:)
gshmkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvl
rdgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

    Sequence, based on observed residues (ATOM records): (download) 
    >3mxcA (A:)
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

  • Chain 'L':
    No sequence available.