PDB entry 3mxb

View 3mxb on RCSB PDB site
Description: Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus
Class: hydrolase/DNA
Keywords: PROTEIN-DNA COMPLEX, HYDROLASE-DNA complex
Deposited on 2010-05-07, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: v3(e8k)
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MXB
    Domains in SCOPe 2.07: d3mxba_
  • Chain 'B':
    Compound: v2(k7e-g19s)
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MXB
    Domains in SCOPe 2.07: d3mxbb_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*tp*gp*tp*tp*cp*tp*cp*ap*gp*gp*tp*ap*cp*cp*tp*cp*ap*gp*cp*cp*ap*gp*a)-3')
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: DNA (5'-d(*tp*cp*tp*gp*gp*cp*tp*gp*ap*gp*gp*tp*ap*cp*cp*tp*gp*ap*gp*ap*ap*cp*ap*a)-3')
    Species: synthetic, synthetic
  • Chain 'R':
    Compound: v3(e8k)
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MXB
    Domains in SCOPe 2.07: d3mxbr_
  • Chain 'S':
    Compound: v2(k7e-g19s)
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MXB
    Domains in SCOPe 2.07: d3mxbs_
  • Chain 'T':
    Compound: DNA (5'-d(*tp*tp*gp*tp*tp*cp*tp*cp*ap*gp*gp*tp*ap*cp*cp*tp*cp*ap*gp*cp*cp*ap*gp*a)-3')
    Species: synthetic, synthetic
  • Chain 'V':
    Compound: DNA (5'-d(*tp*cp*tp*gp*gp*cp*tp*gp*ap*gp*gp*tp*ap*cp*cp*tp*gp*ap*gp*ap*ap*cp*ap*a)-3')
    Species: synthetic, synthetic
  • Heterogens: CA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mxbA (A:)
    mantkynkkfllylagfvdgdgsiiaqinpnqsskfkhrlrltfyvtqktqrrwfldklv
    deigvgyvrdsgsvsqyvlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakesp
    dkflevctwvdqiaalndsktrkttsetvravldslsgkkksspaadwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mxbA (A:)
    ntkynkkfllylagfvdgdgsiiaqinpnqsskfkhrlrltfyvtqktqrrwfldklvde
    igvgyvrdsgsvsqyvlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravlds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mxbB (B:)
    mantkyneefllylagfvdsdgsiiaqikprqsnkfkhqlsltfavtqktqrrwfldklv
    deigvgyvydsgsvsdyrlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakesp
    dkflevctwvdqiaalndsktrkttsetvravldslsekkksspaadhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mxbB (B:)
    ntkyneefllylagfvdsdgsiiaqikprqsnkfkhqlsltfavtqktqrrwfldklvde
    igvgyvydsgsvsdyrlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravlds
    

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3mxbR (R:)
    mantkynkkfllylagfvdgdgsiiaqinpnqsskfkhrlrltfyvtqktqrrwfldklv
    deigvgyvrdsgsvsqyvlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakesp
    dkflevctwvdqiaalndsktrkttsetvravldslsgkkksspaadwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mxbR (R:)
    ntkynkkfllylagfvdgdgsiiaqinpnqsskfkhrlrltfyvtqktqrrwfldklvde
    igvgyvrdsgsvsqyvlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravldsl
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3mxbS (S:)
    mantkyneefllylagfvdsdgsiiaqikprqsnkfkhqlsltfavtqktqrrwfldklv
    deigvgyvydsgsvsdyrlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakesp
    dkflevctwvdqiaalndsktrkttsetvravldslsekkksspaadhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mxbS (S:)
    ntkyneefllylagfvdsdgsiiaqikprqsnkfkhqlsltfavtqktqrrwfldklvde
    igvgyvydsgsvsdyrlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld
    

  • Chain 'T':
    No sequence available.

  • Chain 'V':
    No sequence available.