PDB entry 3mxa

View 3mxa on RCSB PDB site
Description: Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus
Deposited on 2010-05-07, released 2010-10-06
The last revision was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.177
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: scV3V2(G19S)
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MXA
  • Chain 'C':
    Compound: DNA (5'-d(*tp*tp*gp*tp*tp*cp*tp*cp*ap*gp*gp*tp*ap*c)-3')
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: DNA (5'-d(p*cp*tp*cp*ap*gp*cp*cp*ap*gp*a)-3')
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: DNA (5'-d(*tp*cp*tp*gp*gp*cp*tp*gp*ap*gp*gp*tp*ap*c)-3')
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: DNA (5'-d(p*cp*tp*gp*ap*gp*ap*ap*cp*ap*a)-3')
    Species: synthetic, synthetic
  • Heterogens: MN, EOH, 1PE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mxaA (A:)
    mantkynkefllylagfvdgdgsiiaqinpnqsskfkhrlrltfyvtqktqrrwfldklv
    deigvgyvrdsgsvsqyvlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakesp
    dkflevctwvdqiaalndsktrkttsetvravldslsgkkksspaaggsdkynqalskyn
    qalskynqalsggggsnkefllylagfvdsdgsiiaqikprqsnkfkhqlsltfavtqkt
    qrrwfldklvdeigvgyvydsgsvsdyrlseikplhnfltqlqpflklkqkqanlvlkii
    eqlpsakespdkflevctwvdqiaalndsktrkttsetvravldslsekkkssplehhhh
    hh
    

    Sequence, based on observed residues (ATOM records):
    >3mxaA (A:)
    ntkynkefllylagfvdgdgsiiaqinpnqsskfkhrlrltfyvtqktqrrwfldklvde
    igvgyvrdsgsvsqyvlseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravlsnkefllylagfvdsdgsiiaqikprqsn
    kfkhqlsltfavtqktqrrwfldklvdeigvgyvydsgsvsdyrlseikplhnfltqlqp
    flklkqkqanlvlkiieqlpsakespdkflevctwvdqiaalndsktrkttsetvravld
    s
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.