PDB entry 3mx8

View 3mx8 on RCSB PDB site
Description: crystal structure of ribonuclease a tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor
Deposited on 2010-05-07, released 2011-02-09
The last revision was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease pancreatic, LINKER, Ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene: RNS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (128-251)
    • PDB 3MX8 (124-127)
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mx8A (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasvgppgketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesla
    dvqavcsqknvackngqtncyqsystmsitdcretgsskypncaykttqankhiivaceg
    npyvpvhfdasv