PDB entry 3mx7

View 3mx7 on RCSB PDB site
Description: Crystal Structure Analysis of Human FAIM-NTD
Deposited on 2010-05-06, released 2011-05-18
The last revision was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.178
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fas apoptotic inhibitory molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Faim, Faim1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mx7A (A:)
    mtdlvavwdvalsdgvhkiefehgttsgkrvvyvdgkeeirkewmfklvgketfyvgaak
    tkatinidaisgfayeytleingkslkkym