PDB entry 3mx4

View 3mx4 on RCSB PDB site
Description: DNA binding and cleavage by the GIY-YIG endonuclease R.Eco29KI inactive variant E142Q
Deposited on 2010-05-06, released 2010-09-08
The last revision was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.214
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eco29kIR
    Species: Escherichia coli [TaxId:562]
    Gene: eco29kIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46944 (22-234)
      • engineered mutation (89)
      • engineered mutation (162)
  • Chain 'B':
    Compound: Eco29kIR
    Species: Escherichia coli [TaxId:562]
    Gene: eco29kIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46944 (22-234)
      • engineered mutation (89)
      • engineered mutation (162)
  • Chain 'C':
    Compound: Eco29kIR
    Species: Escherichia coli [TaxId:562]
    Gene: eco29kIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46944
      • engineered mutation (89)
      • engineered mutation (162)
  • Chain 'D':
    Compound: Eco29kIR
    Species: Escherichia coli [TaxId:562]
    Gene: eco29kIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46944
      • engineered mutation (89)
      • engineered mutation (162)
  • Chain 'E':
    Compound: Eco29kIR
    Species: Escherichia coli [TaxId:562]
    Gene: eco29kIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46944 (22-End)
      • expression tag (21)
      • engineered mutation (89)
      • engineered mutation (162)
  • Chain 'F':
    Compound: Eco29kIR
    Species: Escherichia coli [TaxId:562]
    Gene: eco29kIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46944 (22-End)
      • engineered mutation (89)
      • engineered mutation (162)
  • Chain 'G':
    Compound: Eco29kIR
    Species: Escherichia coli [TaxId:562]
    Gene: eco29kIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46944 (22-End)
      • engineered mutation (89)
      • engineered mutation (162)
  • Chain 'H':
    Compound: Eco29kIR
    Species: Escherichia coli [TaxId:562]
    Gene: eco29kIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46944 (22-End)
      • engineered mutation (89)
      • engineered mutation (162)
  • Chain 'I':
    Compound: DNA (5'-d(p*cp*gp*gp*gp*ap*gp*gp*cp*cp*cp*gp*cp*gp*gp*gp*cp*cp*gp*cp*cp*gp*c)-3')
  • Chain 'J':
    Compound: DNA (5'-d(p*gp*cp*gp*gp*cp*gp*gp*cp*cp*cp*gp*cp*gp*gp*gp*cp*cp*tp*cp*cp*cp*g)-3')
  • Chain 'K':
    Compound: DNA (5'-d(p*cp*gp*gp*gp*ap*gp*gp*cp*cp*cp*gp*cp*gp*gp*gp*cp*cp*gp*cp*cp*gp*c)-3')
  • Chain 'L':
    Compound: DNA (5'-d(p*gp*cp*gp*gp*cp*gp*gp*cp*cp*cp*gp*cp*gp*gp*gp*cp*cp*tp*cp*cp*cp*g)-3')
  • Chain 'M':
    Compound: DNA (5'-d(p*cp*gp*gp*gp*ap*gp*gp*cp*cp*cp*gp*cp*gp*gp*gp*cp*cp*gp*cp*cp*gp*c)-3')
  • Chain 'N':
    Compound: DNA (5'-d(p*gp*cp*gp*gp*cp*gp*gp*cp*cp*cp*gp*cp*gp*gp*gp*cp*cp*tp*cp*cp*cp*g)-3')
  • Chain 'O':
    Compound: DNA (5'-d(p*cp*gp*gp*gp*ap*gp*gp*cp*cp*cp*gp*cp*gp*gp*gp*cp*cp*gp*cp*cp*gp*c)-3')
  • Chain 'P':
    Compound: DNA (5'-d(p*gp*cp*gp*gp*cp*gp*gp*cp*cp*cp*gp*cp*gp*gp*gp*cp*cp*tp*cp*cp*cp*g)-3')
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mx4A (A:)
    masshhhhhhssglvprgssmghnkkfdrsehvyrndsflelikdavrffsgtpvhslpp
    perfqgagvyalyytghyslydeysrinrkaynlpiyvgkavpagwrqsrisdhetrags
    elsnrirehgrniaktsnldlcdfscrfvifeatgsdmistvqaalikiykplwntvvdg
    fgnhtpgagrfaqaksdwdvihpgrewaekctgvhsepyfieerikqyfsksnft
    

    Sequence, based on observed residues (ATOM records):
    >3mx4A (A:)
    hnkkfdrsehvyrndsflelikdavrffsgtpvhslppperfqgagvyalyytghyslyd
    eysrinrkaynlpiyvgkavpagwrqsrisdhetragselsnrirehgrniaktsnldlc
    dfscrfvifeatgsdmistvqaalikiykplwntvvdgfgnhtpgagrfaqaksdwdvih
    pgrewaekctgvhsepyfieerikqyfsksnft
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mx4B (B:)
    masshhhhhhssglvprgssmghnkkfdrsehvyrndsflelikdavrffsgtpvhslpp
    perfqgagvyalyytghyslydeysrinrkaynlpiyvgkavpagwrqsrisdhetrags
    elsnrirehgrniaktsnldlcdfscrfvifeatgsdmistvqaalikiykplwntvvdg
    fgnhtpgagrfaqaksdwdvihpgrewaekctgvhsepyfieerikqyfsksnft
    

    Sequence, based on observed residues (ATOM records):
    >3mx4B (B:)
    hnkkfdrsehvyrndsflelikdavrffsgtpvhslppperfqgagvyalyytghyslyd
    eysrinrkaynlpiyvgkavpagwrqsrisdhetragselsnrirehgrniaktsnldlc
    dfscrfvifeatgsdmistvqaalikiykplwntvvdgfgnhtpgagrfaqaksdwdvih
    pgrewaekctgvhsepyfieerikqyfsksnft
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mx4C (C:)
    masshhhhhhssglvprgssmghnkkfdrsehvyrndsflelikdavrffsgtpvhslpp
    perfqgagvyalyytghyslydeysrinrkaynlpiyvgkavpagwrqsrisdhetrags
    elsnrirehgrniaktsnldlcdfscrfvifeatgsdmistvqaalikiykplwntvvdg
    fgnhtpgagrfaqaksdwdvihpgrewaekctgvhsepyfieerikqyfsksnft
    

    Sequence, based on observed residues (ATOM records):
    >3mx4C (C:)
    kkfdrsehvyrndsflelikdavrffsgtpvhslppperfqgagvyalyytghyslydey
    srinrkaynlpiyvgkavpagwrqsrisdhetragselsnrirehgrniaktsnldlcdf
    scrfvifeatgsdmistvqaalikiykplwntvvdgfgnhtpgagrfaqaksdwdvihpg
    rewaekctgvhsepyfieerikqyfsks
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mx4D (D:)
    masshhhhhhssglvprgssmghnkkfdrsehvyrndsflelikdavrffsgtpvhslpp
    perfqgagvyalyytghyslydeysrinrkaynlpiyvgkavpagwrqsrisdhetrags
    elsnrirehgrniaktsnldlcdfscrfvifeatgsdmistvqaalikiykplwntvvdg
    fgnhtpgagrfaqaksdwdvihpgrewaekctgvhsepyfieerikqyfsksnft
    

    Sequence, based on observed residues (ATOM records):
    >3mx4D (D:)
    kfdrsehvyrndsflelikdavrffsgtpvhslppperfqgagvyalyytghyslydeys
    rinrkaynlpiyvgkavpagwrqsrisdhetragselsnrirehgrniaktsnldlcdfs
    crfvifeatgsdmistvqaalikiykplwntvvdgfgnhtpgagrfaqaksdwdvihpgr
    ewaekctgvhsepyfieerikqyfsksn
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mx4E (E:)
    masshhhhhhssglvprgssmghnkkfdrsehvyrndsflelikdavrffsgtpvhslpp
    perfqgagvyalyytghyslydeysrinrkaynlpiyvgkavpagwrqsrisdhetrags
    elsnrirehgrniaktsnldlcdfscrfvifeatgsdmistvqaalikiykplwntvvdg
    fgnhtpgagrfaqaksdwdvihpgrewaekctgvhsepyfieerikqyfsksnft
    

    Sequence, based on observed residues (ATOM records):
    >3mx4E (E:)
    ghnkkfdrsehvyrndsflelikdavrffsgtpvhslppperfqgagvyalyytghysly
    deysrinrkaynlpiyvgkavpagwrqsrisdhetragselsnrirehgrniaktsnldl
    cdfscrfvifeatgsdmistvqaalikiykplwntvvdgfgnhtpgagrfaqaksdwdvi
    hpgrewaekctgvhsepyfieerikqyfsks
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mx4F (F:)
    masshhhhhhssglvprgssmghnkkfdrsehvyrndsflelikdavrffsgtpvhslpp
    perfqgagvyalyytghyslydeysrinrkaynlpiyvgkavpagwrqsrisdhetrags
    elsnrirehgrniaktsnldlcdfscrfvifeatgsdmistvqaalikiykplwntvvdg
    fgnhtpgagrfaqaksdwdvihpgrewaekctgvhsepyfieerikqyfsksnft
    

    Sequence, based on observed residues (ATOM records):
    >3mx4F (F:)
    hnkkfdrsehvyrndsflelikdavrffsgtpvhslppperfqgagvyalyytghyslyd
    eysrinrkaynlpiyvgkavpagwrqsrisdhetragselsnrirehgrniaktsnldlc
    dfscrfvifeatgsdmistvqaalikiykplwntvvdgfgnhtpgagrfaqaksdwdvih
    pgrewaekctgvhsepyfieerikqyfsks
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3mx4G (G:)
    masshhhhhhssglvprgssmghnkkfdrsehvyrndsflelikdavrffsgtpvhslpp
    perfqgagvyalyytghyslydeysrinrkaynlpiyvgkavpagwrqsrisdhetrags
    elsnrirehgrniaktsnldlcdfscrfvifeatgsdmistvqaalikiykplwntvvdg
    fgnhtpgagrfaqaksdwdvihpgrewaekctgvhsepyfieerikqyfsksnft
    

    Sequence, based on observed residues (ATOM records):
    >3mx4G (G:)
    hnkkfdrsehvyrndsflelikdavrffsgtpvhslppperfqgagvyalyytghyslyd
    eysrinrkaynlpiyvgkavpagwrqsrisdhetragselsnrirehgrniaktsnldlc
    dfscrfvifeatgsdmistvqaalikiykplwntvvdgfgnhtpgagrfaqaksdwdvih
    pgrewaekctgvhsepyfieerikqyfs
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3mx4H (H:)
    masshhhhhhssglvprgssmghnkkfdrsehvyrndsflelikdavrffsgtpvhslpp
    perfqgagvyalyytghyslydeysrinrkaynlpiyvgkavpagwrqsrisdhetrags
    elsnrirehgrniaktsnldlcdfscrfvifeatgsdmistvqaalikiykplwntvvdg
    fgnhtpgagrfaqaksdwdvihpgrewaekctgvhsepyfieerikqyfsksnft
    

    Sequence, based on observed residues (ATOM records):
    >3mx4H (H:)
    hnkkfdrsehvyrndsflelikdavrffsgtpvhslppperfqgagvyalyytghyslyd
    eysrinrkaynlpiyvgkavpagwrqsrisdhetragselsnrirehgrniaktsnldlc
    dfscrfvifeatgsdmistvqaalikiykplwntvvdgfgnhtpgagrfaqaksdwdvih
    pgrewaekctgvhsepyfieerikqyfsk
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.