PDB entry 3mx3

View 3mx3 on RCSB PDB site
Description: Crystal structure of a SusD homolog (BF0972) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution
Class: structural genomics, unknown function
Keywords: Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2010-05-06, released 2010-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SusD homolog
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF0972
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LGM6 (Start-489)
      • see remark 999 (401)
    Domains in SCOPe 2.07: d3mx3a_
  • Chain 'B':
    Compound: SusD homolog
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF0972
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LGM6 (Start-489)
      • see remark 999 (401)
    Domains in SCOPe 2.07: d3mx3b_
  • Heterogens: MG, EPE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mx3A (A:)
    gascdkfdeintdpdattkvtssllatglllditsssasksfiydellakqmawgesmed
    yqynvfgrsgfggyttlinaqkmvesvsddnvnaydglahfikaykifymsmemgdlpye
    ealqgelglvrpkyntqkevmnfilsdletayelfstakdfdgdpilggsiskwkkatta
    fqlkvlmhlskkesdadlkvkerfarivasgslmesnednlqmkyadkantvypfhntnt
    khagyamlstmlidkfkatgdirmfyyakpakaklnegvtadswdayigtdpslpfeqie
    kayateqysgfnarytdypsgepvvrlgyaeqnfilaeaavrgwisgdasayykkairah
    mefiasntpdeevyhhghpiteeaiaafletpaiqlsgekeediekiltqrylasfmqhp
    ydvyydyrrtgypvlpinpatnrntmndrlpmrwmypksesdynlehqnealerqfggvd
    dvnklmwilq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mx3A (A:)
    kvtssllatglllditsssasksfiydellakqmawgesmedyqynvfgrsgfggyttli
    naqkmvesvsddnvnaydglahfikaykifymsmemgdlpyeealqgelglvrpkyntqk
    evmnfilsdletayelfstakdfdgdpilggsiskwkkattafqlkvlmhlskkesdadl
    kvkerfarivasgslmesnednlqmkyaantvypfhntntkhagyamlstmlidkfkatg
    dirmfyyakpakaklnegvtadswdayigtdpslpfeqiekayateqysgfnarytdyps
    gepvvrlgyaeqnfilaeaavrgwisgdasayykkairahmefiasntpdeevyhhghpi
    teeaiaafletpaiqlsgekeediekiltqrylasfmqhpydvyydyrrtgypvlpinpa
    tnrntmndrlpmrwmypksesdynlehqnealerqfggvddvnklmwilq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mx3B (B:)
    gascdkfdeintdpdattkvtssllatglllditsssasksfiydellakqmawgesmed
    yqynvfgrsgfggyttlinaqkmvesvsddnvnaydglahfikaykifymsmemgdlpye
    ealqgelglvrpkyntqkevmnfilsdletayelfstakdfdgdpilggsiskwkkatta
    fqlkvlmhlskkesdadlkvkerfarivasgslmesnednlqmkyadkantvypfhntnt
    khagyamlstmlidkfkatgdirmfyyakpakaklnegvtadswdayigtdpslpfeqie
    kayateqysgfnarytdypsgepvvrlgyaeqnfilaeaavrgwisgdasayykkairah
    mefiasntpdeevyhhghpiteeaiaafletpaiqlsgekeediekiltqrylasfmqhp
    ydvyydyrrtgypvlpinpatnrntmndrlpmrwmypksesdynlehqnealerqfggvd
    dvnklmwilq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mx3B (B:)
    kvtssllatglllditsssasksfiydellakqmawgesmedyqynvfgrsgfggyttli
    naqkmvesvsddnvnaydglahfikaykifymsmemgdlpyeealqgelglvrpkyntqk
    evmnfilsdletayelfstakdfdgdpilggsiskwkkattafqlkvlmhlskkesdadl
    kvkerfarivasgslmesnednlqmkyaantvypfhntntkhagyamlstmlidkfkatg
    dirmfyyakpakaklnegvtadswdayigtdpslpfeqiekayateqysgfnarytdyps
    gepvvrlgyaeqnfilaeaavrgwisgdasayykkairahmefiasntpdeevyhhghpi
    teeaiaafletpaiqlsgekeediekiltqrylasfmqhpydvyydyrrtgypvlpinpa
    tnrntmndrlpmrwmypksesdynlehqnealerqfggvddvnklmwilq