PDB entry 3mx2

View 3mx2 on RCSB PDB site
Description: Lassa fever virus Nucleoprotein complexed with dTTP
Class: nuclear protein
Keywords: Nucleoprotein, Lassa fever virus, Structural Genomics, Scottish Structural Proteomics Facility, SSPF, NUCLEAR PROTEIN
Deposited on 2010-05-06, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoprotein
    Species: Lassa virus [TaxId:11622]
    Gene: N, nucleoprotein
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mx2a1, d3mx2a2
  • Chain 'B':
    Compound: nucleoprotein
    Species: Lassa virus [TaxId:11622]
    Gene: N, nucleoprotein
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mx2b1, d3mx2b2
  • Chain 'C':
    Compound: nucleoprotein
    Species: Lassa virus [TaxId:11622]
    Gene: N, nucleoprotein
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mx2c1, d3mx2c2
  • Heterogens: TTP, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mx2A (A:)
    gamdhvefmsaskeiksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqr
    lmrkerrddndlkrlrdlnqavnnlvelkstqqksilrvgtltsddllilaadleklksk
    virterplsagvymgnlssqqldqrrallnmigmsggnqgaragrdgvvrvwdvknaell
    nnqfgtmpsltlacltkqgqvdlndavqaltdlgliytakypntsdldrltqshpilnmi
    dtkksslnisgynfslgaavkagacmldggnmletikvspqtmdgilksilkvkkalgmf
    isdtpgernpyenilykiclsgdgwpyiasrtsitgrawentvvdlesdgkpqkadsnns
    skslqsagftagltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyih
    ffreptdlkqfkqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirklle
    sqgrkdiklidialsktdsrkyenavwdqykdlchmhtgvvvekkkrggkeeitphcalm
    dcimfdaavsgglntsvlravlprdmvfrtstprvvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mx2A (A:)
    iksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkerrddndlkr
    lrdlnqavnnlvelkstqqksilrvgtltsddllilaadleklkskvirterplsagvym
    gnlssqqldqrrallnmigmdgvvrvwdvknaellnnqfgtmpsltlacltkqgqvdlnd
    avqaltdlgliytakypntsdldrltqshpilnmidtkksslnisgynfslgaavkagac
    mldggnmletikvspqtmdgilksilkvkkalgmfisdtpgernpyenilykiclsgdgw
    pyiasrtsitgrawentvvdlgltysqlmtlkdamlqldpnaktwmdiegrpedpveial
    yqpssgcyihffreptdlkqfkqdakyshgidvtdlfatqpgltsavidalprnmvitcq
    gsddirkllesqgrkdiklidialsktdsrkyenavwdqykdlchmhtgvvvekkeeitp
    hcalmdcimfdaavsgglntsvlravlprdmvfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mx2B (B:)
    gamdhvefmsaskeiksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqr
    lmrkerrddndlkrlrdlnqavnnlvelkstqqksilrvgtltsddllilaadleklksk
    virterplsagvymgnlssqqldqrrallnmigmsggnqgaragrdgvvrvwdvknaell
    nnqfgtmpsltlacltkqgqvdlndavqaltdlgliytakypntsdldrltqshpilnmi
    dtkksslnisgynfslgaavkagacmldggnmletikvspqtmdgilksilkvkkalgmf
    isdtpgernpyenilykiclsgdgwpyiasrtsitgrawentvvdlesdgkpqkadsnns
    skslqsagftagltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyih
    ffreptdlkqfkqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirklle
    sqgrkdiklidialsktdsrkyenavwdqykdlchmhtgvvvekkkrggkeeitphcalm
    dcimfdaavsgglntsvlravlprdmvfrtstprvvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mx2B (B:)
    ksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkerrddndlkrl
    rdlnqavnnlvelkstqqksilrvgtltsddllilaadleklkskvirterplsagvymg
    nlssqqldqrrallnmigmagrdgvvrvwdvknaellnnqfgtmpsltlacltkqgqvdl
    ndavqaltdlgliytakypntsdldrltqshpilnmidtkksslnisgynfslgaavkag
    acmldggnmletikvspqtmdgilksilkvkkalgmfisdtpgernpyenilykiclsgd
    gwpyiasrtsitgrawentvvdlgltysqlmtlkdamlqldpnaktwmdiegrpedpvei
    alyqpssgcyihffreptdlkqfkqdakyshgidvtdlfatqpgltsavidalprnmvit
    cqgsddirkllesqgrkdiklidialsktdsrkyenavwdqykdlchmhtgvvvekkkee
    itphcalmdcimfdaavsgglntsvlravlprdmvfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mx2C (C:)
    gamdhvefmsaskeiksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqr
    lmrkerrddndlkrlrdlnqavnnlvelkstqqksilrvgtltsddllilaadleklksk
    virterplsagvymgnlssqqldqrrallnmigmsggnqgaragrdgvvrvwdvknaell
    nnqfgtmpsltlacltkqgqvdlndavqaltdlgliytakypntsdldrltqshpilnmi
    dtkksslnisgynfslgaavkagacmldggnmletikvspqtmdgilksilkvkkalgmf
    isdtpgernpyenilykiclsgdgwpyiasrtsitgrawentvvdlesdgkpqkadsnns
    skslqsagftagltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyih
    ffreptdlkqfkqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirklle
    sqgrkdiklidialsktdsrkyenavwdqykdlchmhtgvvvekkkrggkeeitphcalm
    dcimfdaavsgglntsvlravlprdmvfrtstprvvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mx2C (C:)
    ksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkerrddndlkrl
    rdlnqavnnlvelkstqqksilrvgtltsddllilaadleklkskvirterplsagvymg
    nlssqqldqrrallnmigmdgvvrvwdvknaellnnqfgtmpsltlacltkqgqvdlnda
    vqaltdlgliytakypntsdldrltqshpilnmidtksslnisgynfslgaavkagacml
    dggnmletikvspqtmdgilksilkvkkalgmfisdtpgernpyenilykiclsgdgwpy
    iasrtsitgrawentvvdlgltysqlmtlkdamlqldpnaktwmdiegrpedpveialyq
    pssgcyihffreptdlkqfkqdakyshgidvtdlfatqpgltsavidalprnmvitcqgs
    ddirkllesqgrkdiklidialsktdsrkyenavwdqykdlchmhtgvvvekkkeeitph
    calmdcimfdaavsgglntsvlravlprdmvfr