PDB entry 3mx1

View 3mx1 on RCSB PDB site
Description: The structure of GIY-YIG endonuclease R.Eco29kI
Deposited on 2010-05-06, released 2010-09-08
The last revision was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eco29kIR
    Species: Escherichia coli [TaxId:562]
    Gene: eco29kIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46944
      • engineered mutation (162)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mx1A (A:)
    masshhhhhhssglvprgssmghnkkfdrsehvyrndsflelikdavrffsgtpvhslpp
    perfqgagvyalyytghyslydeysrinrlaynlpiyvgkavpagwrqsrisdhetrags
    elsnrirehgrniaktsnldlcdfscrfvifeatgsdmistvqaalikiykplwntvvdg
    fgnhtpgagrfaqaksdwdvihpgrewaekctgvhsepyfieerikqyfsksnft
    

    Sequence, based on observed residues (ATOM records):
    >3mx1A (A:)
    nkkfdrsehvyrndsflelikdavrffsgtpvhslppperfqgagvyalyytghyslyde
    ysrinrlaynlpiyvgkavpagwrqsrisdhetragselsnrirehgrniaktsnldlcd
    fscrfvifeatgsdmistvqaalikiykplwntvvdgfgnhtpgagrfaqaksdwdvihp
    grewaekctgvhsepyfieerikqyfsk