PDB entry 3mwz

View 3mwz on RCSB PDB site
Description: Crystal structure of the selenomethionine derivative of the L 22,47,100 M mutant of sialostatin L2
Class: hydrolase inhibitor
Keywords: antiparallel beta-sheet, HYDROLASE INHIBITOR
Deposited on 2010-05-06, released 2010-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.176
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialostatin L2
    Species: Ixodes scapularis [TaxId:6945]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4PMS6 (1-114)
      • expression tag (0)
      • engineered mutation (22)
      • engineered mutation (47)
      • engineered mutation (100)
    Domains in SCOPe 2.08: d3mwza1, d3mwza2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mwzA (A:)
melalrggyrersnqddpeylemahyatstwsaqqpgkthfdtvvevmkvetqtvagtny
rltlkvaestceltstynkdtcqananaaqrtcttviyrnmqgeksinsfecaaa