PDB entry 3mww

View 3mww on RCSB PDB site
Description: Crystal structure of HCV NS5B polymerase
Class: transferase
Keywords: HCV virus RdRP NS5B polymerase inhibitor, TRANSFERASE
Deposited on 2010-05-06, released 2010-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Hepatitis C virus [TaxId:420174]
    Gene: NS5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mwwa_
  • Chain 'B':
    Compound: Genome polyprotein
    Species: Hepatitis C virus [TaxId:420174]
    Gene: NS5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mwwb_
  • Heterogens: SO4, BIW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mwwA (A:)
    smsytwtgalitpcaaeesklpinplsnsllrhhnmvyattsrsaslrqkkvtfdrlqvl
    ddhyrdvlkemkakastvkakllsieeackltpphsakskfgygakdvrnlssravnhir
    svwedlledtetpidttimaksevfcvqpekggrkparlivfpdlgvrvcekmalydvvs
    tlpqavmgssygfqyspkqrveflvntwkskkcpmgfsydtrcfdstvtesdirveesiy
    qccdlapearqairslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkat
    aacraaklqdctmlvngddlvvicesagtqedaaalrafteamtrysappgdppqpeydl
    elitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpinswlgniimyaptlw
    armilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsaftlhsyspg
    einrvasclrklgvpplrtwrhrarsvrakllsqggraatcgrylfnwavrtklkltpip
    aasqldlsgwfvagysggdiyhslsrarprhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mwwA (A:)
    smsytwtgalitpcaaeesklpinplsnsllrhhnmvyattsrsaslrqkkvtfdrlqvl
    ddhyrdvlkemkakastvkakllsieeackltpphsakskfgygakdvrnlssravnhir
    svwedlledtetpidttimaksevfcvqprkparlivfpdlgvrvcekmalydvvstlpq
    avmgssygfqyspkqrveflvntwkskkcpmgfsydtrcfdstvtesdirveesiyqccd
    lapearqairslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkataacr
    aaklqdctmlvngddlvvicesagtqedaaalrafteamtrysappgdppqpeydlelit
    scssnvsvahdasgkrvyyltrdpttplaraawetarhtpinswlgniimyaptlwarmi
    lmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsaftlhsyspgeinr
    vasclrklgvpplrtwrhrarsvrakllsqggraatcgrylfnwavrtklkltpipaasq
    ldlsgwfvagysggdiyhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mwwB (B:)
    smsytwtgalitpcaaeesklpinplsnsllrhhnmvyattsrsaslrqkkvtfdrlqvl
    ddhyrdvlkemkakastvkakllsieeackltpphsakskfgygakdvrnlssravnhir
    svwedlledtetpidttimaksevfcvqpekggrkparlivfpdlgvrvcekmalydvvs
    tlpqavmgssygfqyspkqrveflvntwkskkcpmgfsydtrcfdstvtesdirveesiy
    qccdlapearqairslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkat
    aacraaklqdctmlvngddlvvicesagtqedaaalrafteamtrysappgdppqpeydl
    elitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpinswlgniimyaptlw
    armilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsaftlhsyspg
    einrvasclrklgvpplrtwrhrarsvrakllsqggraatcgrylfnwavrtklkltpip
    aasqldlsgwfvagysggdiyhslsrarprhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mwwB (B:)
    smsytwtgalitpcaaemvyattsrsaslrqkkvtfdrlqvlddhyrdvlkemkakastv
    kakllsieeackltpphsakskfgygakdvrnlssravnhirsvwedlledtetpidtti
    maksevfcvqgrkparlivfpdlgvrvcekmalydvvstlpqavmgssygfqyspkqrve
    flvntwkskkcpmgfsydtrcfdstvtesdirveesiyqccdlapearqairslterlyi
    ggpltnskgqncgyrrcrasgvlttscgntltcylkataacraaklqdctmlvngddlvv
    icesagtqedaaalrafteamtrysappgdppqpeydlelitscssnvsvahdasgkrvy
    yltrdpttplaraawetarhtpinswlgniimyaptlwarmilmthffsillaqeqleka
    ldcqiygacysiepldlpqiierlhglsaftlhsyspgeinrvasclrklgvpplrtwrh
    rarsvrakllsqggraatcgrylfnwavrtklkltpipaasqldlsgwfvagysggdiyh
    s