PDB entry 3mwu

View 3mwu on RCSB PDB site
Description: Activated Calcium-Dependent Protein Kinase 1 from Cryptosporidium parvum (CpCDPK1) in complex with bumped kinase inhibitor RM-1-95
Deposited on 2010-05-06, released 2010-07-21
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin-domain protein kinase 1
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: CDPK1, cgd3_920
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3FQ16 (17-End)
      • expression tag (13-16)
  • Heterogens: CA, BK3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mwuA (A:)
    mhhhhhhssgrenlyfqgtfaerynivcmlgkgsfgevlkckdritqqeyavkvinkasa
    knkdtstilrevellkkldhpnimklfeiledsssfyivgelytggelfdeiikrkrfse
    hdaariikqvfsgitymhkhnivhrdlkpenilleskekdcdikiidfglstcfqqntkm
    kdrigtayyiapevlrgtydekcdvwsagvilyillsgtppfygkneydilkrvetgkya
    fdlpqwrtisddakdlirkmltfhpslritatqclehpwiqkyssetptisdlpslesam
    tnirqfqaekklaqaallymasklttldetkqlteifrkldtnndgmldrdelvrgyhef
    mrlkgvdsnsliqnegstiedqidslmplldmdgsgsieysefiasaidrtillsrerme
    rafkmfdkdgsgkistkelfklfsqadssiqmeelesiieqvdnnkdgevdfnefvemlq
    nfvrne
    

    Sequence, based on observed residues (ATOM records):
    >3mwuA (A:)
    lyfqgtfaerynivcmlgkgsfgevlkckdritqqeyavkvinkasaknkdtstilreve
    llkkldhpnimklfeiledsssfyivgelytggelfdeiikrkrfsehdaariikqvfsg
    itymhkhnivhrdlkpenilleskekdcdikiidfglstcfqqndrigtayyiapevlrg
    tydekcdvwsagvilyillsgtppfygkneydilkrvetgkyafdlpqwrtisddakdli
    rkmltfhpslritatqclehpwiqkyssetptisdlpslesamtnirqfqaekklaqaal
    lymasklttldetkqlteifrkldtnndgmldrdelvrgyhefmrlkgvdsnsliqnegs
    tiedqidslmplldmdgsgsieysefiasaidrtillsrermerafkmfdkdgsgkistk
    eleqvdnnkdgevdfnefvemlqnfvr