PDB entry 3mws
View 3mws on RCSB PDB site
Description: Crystal Structure of Group N HIV-1 Protease
Class: Hydrolase/Hydrolase Inhibitor
Keywords: HIV-1, Hydrolase-Hydrolase Inhibitor complex
Deposited on
2010-05-06, released
2011-03-23
The last revision prior to the SCOPe 2.03 freeze date was dated
2011-03-30, with a file datestamp of
2011-03-25.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: 0.167
AEROSPACI score: 0.89
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: GAG, POL
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3mwsa_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: GAG, POL
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3mwsb_ - Heterogens: CL, 017, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3mwsA (A:)
pqitlwqrpvitvkigkevrealldtgaddtvieeiqlegkwkpkmiggiggfikvrqyd
nvtidiqgrkavgtvlvgptpvniigrnfltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3mwsB (B:)
pqitlwqrpvitvkigkevrealldtgaddtvieeiqlegkwkpkmiggiggfikvrqyd
nvtidiqgrkavgtvlvgptpvniigrnfltqigatlnf