PDB entry 3mwp

View 3mwp on RCSB PDB site
Description: Nucleoprotein structure of lassa fever virus
Class: nuclear protein
Keywords: Nucleoprotein, Structural Genomics, Scottish Structural Proteomics Facility, SSPF, NUCLEAR PROTEIN
Deposited on 2010-05-06, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.179
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoprotein
    Species: Lassa virus Josiah [TaxId:11622]
    Gene: N, nucleoprotein
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mwpa1, d3mwpa2
  • Chain 'B':
    Compound: nucleoprotein
    Species: Lassa virus Josiah [TaxId:11622]
    Gene: N, nucleoprotein
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mwpb1, d3mwpb2
  • Chain 'C':
    Compound: nucleoprotein
    Species: Lassa virus Josiah [TaxId:11622]
    Gene: N, nucleoprotein
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mwpc1, d3mwpc2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mwpA (A:)
    gamdhvefmsaskeiksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqr
    lmrkerrddndlkrlrdlnqavnnlvelkstqqksilrvgtltsddllilaadleklksk
    virterplsagvymgnlssqqldqrrallnmigmsggnqgaragrdgvvrvwdvknaell
    nnqfgtmpsltlacltkqgqvdlndavqaltdlgliytakypntsdldrltqshpilnmi
    dtkksslnisgynfslgaavkagacmldggnmletikvspqtmdgilksilkvkkalgmf
    isdtpgernpyenilykiclsgdgwpyiasrtsitgrawentvvdlesdgkpqkadsnns
    skslqsagftagltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyih
    ffreptdlkqfkqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirklle
    sqgrkdiklidialsktdsrkyenavwdqykdlchmhtgvvvekkkrggkeeitphcalm
    dcimfdaavsgglntsvlravlprdmvfrtstprvvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mwpA (A:)
    iksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkerrddndlkr
    lrdlnqavnnlvelkstqqksilrvgtltsddllilaadleklkskvirterplsagvym
    gnlssqqldqrrallnmigmdgvvrvwdvknaellnnqfgtmpsltlacltkqgqvdlnd
    avqaltdlgliytakypntsdldrltqshpilnmidtkksslnisgynfslgaavkagac
    mldggnmletikvspqtmdgilksilkvkkalgmfisdtpgernpyenilykiclsgdgw
    pyiasrtsitgrawentvvdlgltysqlmtlkdamlqldpnaktwmdiegrpedpveial
    yqpssgcyihffreptdlkqfkqdakyshgidvtdlfatqpgltsavidalprnmvitcq
    gsddirkllesqgrkdiklidialsktdsrkyenavwdqykdlchmhtgvvvekkeeitp
    hcalmdcimfdaavsgglsvlravlprdmvfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mwpB (B:)
    gamdhvefmsaskeiksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqr
    lmrkerrddndlkrlrdlnqavnnlvelkstqqksilrvgtltsddllilaadleklksk
    virterplsagvymgnlssqqldqrrallnmigmsggnqgaragrdgvvrvwdvknaell
    nnqfgtmpsltlacltkqgqvdlndavqaltdlgliytakypntsdldrltqshpilnmi
    dtkksslnisgynfslgaavkagacmldggnmletikvspqtmdgilksilkvkkalgmf
    isdtpgernpyenilykiclsgdgwpyiasrtsitgrawentvvdlesdgkpqkadsnns
    skslqsagftagltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyih
    ffreptdlkqfkqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirklle
    sqgrkdiklidialsktdsrkyenavwdqykdlchmhtgvvvekkkrggkeeitphcalm
    dcimfdaavsgglntsvlravlprdmvfrtstprvvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mwpB (B:)
    ksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkerrddndlkrl
    rdlnqavnnlvelkstqqksilrvgtltsddllilaadleklkskvirterplsagvymg
    nlssqqldqrrallnmigmsdgvvrvwdvknaellnnqfgtmpsltlacltkqgqvdlnd
    avqaltdlgliytakypntsdldrltqshpilnmidtkksslnisgynfslgaavkagac
    mldggnmletikvspqtmdgilksilkvkkalgmfisdtpgernpyenilykiclsgdgw
    pyiasrtsitgrawentvvdlgltysqlmtlkdamlqldpnaktwmdiegrpedpveial
    yqpssgcyihffreptdlkqfkqdakyshgidvtdlfatqpgltsavidalprnmvitcq
    gsddirkllesqgrkdiklidialsktdsrkyenavwdqykdlchmhtgvvvekkkeeit
    phcalmdcimfdaavsgglntsvlravlprdmvfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mwpC (C:)
    gamdhvefmsaskeiksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqr
    lmrkerrddndlkrlrdlnqavnnlvelkstqqksilrvgtltsddllilaadleklksk
    virterplsagvymgnlssqqldqrrallnmigmsggnqgaragrdgvvrvwdvknaell
    nnqfgtmpsltlacltkqgqvdlndavqaltdlgliytakypntsdldrltqshpilnmi
    dtkksslnisgynfslgaavkagacmldggnmletikvspqtmdgilksilkvkkalgmf
    isdtpgernpyenilykiclsgdgwpyiasrtsitgrawentvvdlesdgkpqkadsnns
    skslqsagftagltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpssgcyih
    ffreptdlkqfkqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddirklle
    sqgrkdiklidialsktdsrkyenavwdqykdlchmhtgvvvekkkrggkeeitphcalm
    dcimfdaavsgglntsvlravlprdmvfrtstprvvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mwpC (C:)
    ksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkerrddndlkrl
    rdlnqavnnlvelkstqqksilrvgtltsddllilaadleklkskvirterplsagvymg
    nlssqqldqrrallnmigmdgvvrvwdvknaellnnqfgtmpsltlacltkqgqvdlnda
    vqaltdlgliytakypntsdldrltqshpilnmidtsslnisgynfslgaavkagacmld
    gnmletikvspqtmdgilksilkvkkalgmfisdtpgernpyenilykiclsgdgwpyia
    srtsitgrawentvvdgltysqlmtlkdamlqldpnaktwmdiegrpedpveialyqpss
    gcyihffreptdlkqfkqdakyshgidvtdlfatqpgltsavidalprnmvitcqgsddi
    rkllesqgrkdiklidialsktdsrkyenavwdqykdlchmhtgvvvekkeeitphcalm
    dcimfdaavsgglvlravlprdmvfr