PDB entry 3mwj

View 3mwj on RCSB PDB site
Description: Q28E mutant of HERA N-terminal RecA-like domain, apo form
Class: hydrolase
Keywords: RNA helicase, ribosome biogenesis, thermophilic, hydrolase, ATPase
Deposited on 2010-05-06, released 2011-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.143
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat resistant RNA dependent ATPase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: TT_C1895
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72GF3 (0-206)
      • engineered mutation (27)
    Domains in SCOPe 2.07: d3mwja_
  • Chain 'B':
    Compound: heat resistant RNA dependent ATPase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: TT_C1895
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72GF3 (0-206)
      • engineered mutation (27)
    Domains in SCOPe 2.07: d3mwjb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mwjA (A:)
    mefkdfplkpeilealhgrglttptpieaaalplalegkdligqartgtgktlafalpia
    erlapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrg
    adavvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtll
    fsatlpswakrlaerymknpvlinvik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mwjB (B:)
    mefkdfplkpeilealhgrglttptpieaaalplalegkdligqartgtgktlafalpia
    erlapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrg
    adavvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtll
    fsatlpswakrlaerymknpvlinvik