PDB entry 3mwi

View 3mwi on RCSB PDB site
Description: The complex crystal Structure of Urokianse and 5-nitro-1H-indole-2-amidine
Class: hydrolase
Keywords: hydrolase
Deposited on 2010-05-06, released 2011-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.219
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'U':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: Human
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-245)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d3mwiu_
  • Heterogens: B25, SO4, HOH

PDB Chain Sequences:

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mwiU (U:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    alpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtk