PDB entry 3mwh

View 3mwh on RCSB PDB site
Description: the 1.4 ang crystal structure of the arsd arsenic metallochaperone provides insights into its interactions with the arsa atpase
Deposited on 2010-05-05, released 2010-05-26
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arsenical resistance operon trans-acting repressor arsD
    Species: Escherichia coli [TaxId:562]
    Gene: arsD, R773
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Arsenical resistance operon trans-acting repressor arsD
    Species: Escherichia coli [TaxId:562]
    Gene: arsD, R773
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mwhA (A:)
    mktlmvfdpamccstgvcgtdvdqalvdfstdvqwlkqcgvqierfnlaqqpmsfvqnek
    vkafieasgaeglplllldgetvmagrypkraelarwfgipldkvglapg
    

    Sequence, based on observed residues (ATOM records):
    >3mwhA (A:)
    mktlmvfdptdvdqalvdfstdvqwlkqcgvqierfnlaqqpmsfvqnekvkafieasga
    eglplllldgetvmagrypkraelarwfgipldkvglap
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mwhB (B:)
    mktlmvfdpamccstgvcgtdvdqalvdfstdvqwlkqcgvqierfnlaqqpmsfvqnek
    vkafieasgaeglplllldgetvmagrypkraelarwfgipldkvglapg
    

    Sequence, based on observed residues (ATOM records):
    >3mwhB (B:)
    mktlmvfdpamdqalvdfstdvqwlkqcgvqierfnlaqqpmsfvqnekvkafieasgae
    glplllldgetvmagrypkraelarwfgipldkvgla