PDB entry 3mwg

View 3mwg on RCSB PDB site
Description: crystal structure of staphylococcus aureus sira
Deposited on 2010-05-05, released 2010-09-01
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-regulated ABC transporter siderophore-binding protein SirA
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: SA0111, sirA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Iron-regulated ABC transporter siderophore-binding protein SirA
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: SA0111, sirA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mwgA (A:)
    gskrvvtlyqgatdvavslgvkpvgaveswtqkpkfeyikndlkdtkivgqepapnleei
    sklkpdlivaskvrnekvydqlskiaptvstdtvfkfkdttklmgkalgkekeaedllkk
    yddkvaafqkdakakykdawplkasvvnfradhtriyaggyageilndlgfkrnkdlqkq
    vdngkdiiqltskesiplmnadhifvvksdpnakdaalvkktesewtsskewknldavkn
    nqvsddldeitwnlaggyksslkliddlyeklniekqsk
    

    Sequence, based on observed residues (ATOM records):
    >3mwgA (A:)
    krvvtlyqgatdvavslgvkpvgaveswtqkpkfeyikndlkdtkivgqepapnleeisk
    lkpdlivaskvrnekvydqlskiaptvstdtvfkfkdttklmgkalgkekeaedllkkyd
    dkvaafqkdakakykdawplkasvvnfradhtriyaggyageilndlgfkrnkdlqkqvd
    ngkdiiqltskesiplmnadhifvvksdpnakdaalvkktesewtsskewknldavknnq
    vsddldeitwnlaggyksslkliddlyeklniekqs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mwgB (B:)
    gskrvvtlyqgatdvavslgvkpvgaveswtqkpkfeyikndlkdtkivgqepapnleei
    sklkpdlivaskvrnekvydqlskiaptvstdtvfkfkdttklmgkalgkekeaedllkk
    yddkvaafqkdakakykdawplkasvvnfradhtriyaggyageilndlgfkrnkdlqkq
    vdngkdiiqltskesiplmnadhifvvksdpnakdaalvkktesewtsskewknldavkn
    nqvsddldeitwnlaggyksslkliddlyeklniekqsk
    

    Sequence, based on observed residues (ATOM records):
    >3mwgB (B:)
    krvvtlyqgatdvavslgvkpvgaveswtqkpkfeyikndlkdtkivgqepapnleeisk
    lkpdlivaskvrnekvydqlskiaptvstdtvfkfkdttklmgkalgkekeaedllkkyd
    dkvaafqkdakakykdawplkasvvnfradhtriyaggyageilndlgfkrnkdlqkqvd
    ngkdiiqltskesiplmnadhifvvksdpnakdaalvkktesewtsskewknldavknnq
    vsddldeitwnlaggyksslkliddlyeklniek