PDB entry 3mwf

View 3mwf on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus SirA complexed with staphyloferrin B
Class: transport protein
Keywords: ABC transporter binding protein, TRANSPORT PROTEIN
Deposited on 2010-05-05, released 2010-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-regulated ABC transporter siderophore-binding protein SirA
    Species: Staphylococcus aureus subsp. aureus [TaxId:158879]
    Gene: SA0111, sirA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mwfa_
  • Heterogens: FE, SE8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mwfA (A:)
    gshmttsikhamgtteikgkpkrvvtlyqgatdvavslgvkpvgaveswtqkpkfeyikn
    dlkdtkivgqepapnleeisklkpdlivaskvrnekvydqlskiaptvstdtvfkfkdtt
    klmgkalgkekeaedllkkyddkvaafqkdakakykdawplkasvvnfradhtriyaggy
    ageilndlgfkrnkdlqkqvdngkdiiqltskesiplmnadhifvvksdpnakdaalvkk
    tesewtsskewknldavknnqvsddldeitwnlaggyksslkliddlyeklniekqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mwfA (A:)
    ttsikhamgtteikgkpkrvvtlyqgatdvavslgvkpvgaveswtqkpkfeyikndlkd
    tkivgqepapnleeisklkpdlivaskvrnekvydqlskiaptvstdtvfkfkdttklmg
    kalgkekeaedllkkyddkvaafqkdakakykdawplkasvvnfradhtriyaggyagei
    lndlgfkrnkdlqkqvdngkdiiqltskesiplmnadhifvvksdpnakdaalvkktese
    wtsskewknldavknnqvsddldeitwnlaggyksslkliddlyeklniekq