PDB entry 3mwd

View 3mwd on RCSB PDB site
Description: Truncated Human ATP-Citrate Lyase with Citrate Bound
Deposited on 2010-05-05, released 2010-06-16
The last revision was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-citrate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: ACLY
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP-citrate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: ACLY
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mwdA (A:)
    msakaiseqtgkellykficttsaiqnrfkyarvtpdtdwarllqdhpwllsqnlvvkpd
    qlikrrgklglvgvnltldgvkswlkprlgqeatvgkatgflknfliepfvphsqaeefy
    vciyatregdyvlfhheggvdvgdvdakaqkllvgvdeklnpedikkhllvhapedkkei
    lasfisglfnfyedlyftyleinplvvtkdgvyvldlaakvdatadyickvkwgdiefpp
    pfgreaypeeayiadldaksgaslkltllnpkgriwtmvagggasvvysdticdlggvne
    lanygeysgapseqqtydyaktilslmtrekhpdgkiliiggsianftnvaatfkgivra
    irdyqgplkehevtifvrrggpnyqeglrvmgevgkttgipihvfgtethmtaivgmalg
    hrpip
    

    Sequence, based on observed residues (ATOM records):
    >3mwdA (A:)
    sakaiseqtgkellykficttsaiqnrfkyarvtpdtdwarllqdhpwllsqnlvvkpdq
    likrrgklglvgvnltldgvkswlkprlgqeatvgkatgflknfliepfvphsqaeefyv
    ciyatregdyvlfhheggvdvgdvdakaqkllvgvdeklnpedikkhllvhapedkkeil
    asfisglfnfyedlyftyleinplvvtkdgvyvldlaakvdatadyickvkwgdiefppp
    fgreaypeeayiadldaksgaslkltllnpkgriwtmvagggasvvysdticdlggvnel
    anygeysgapseqqtydyaktilslmtrekhpdgkiliiggsianftnvaatfkgivrai
    rdyqgplkehevtifvrrggpnyqeglrvmgevgkttgipihvfgtethmtaivgmalgh
    rpip
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mwdB (B:)
    gksttlfsrhtkaivwgmqtravqgmldfdyvcsrdepsvaamvypftgdhkqkfywghk
    eilipvfknmadamrkhpevdvlinfaslrsaydstmetmnyaqirtiaiiaegipealt
    rklikkadqkgvtiigpatvggikpgcfkigntggmldnilasklyrpgsvayvsrsggm
    snelnniisrttdgvyegvaiggdrypgstfmdhvlryqdtpgvkmivvlgeiggteeyk
    icrgikegrltkpivcwcigtcatmfssevqfghagacanqasetavaknqalkeagvfv
    prsfdelgeiiqsvyedlvangvivpaqevpppt
    

    Sequence, based on observed residues (ATOM records):
    >3mwdB (B:)
    gksttlfsrhtkaivwgmqtravqgmldfdyvcsrdepsvaamvypftgdhkqkfywghk
    eilipvfknmadamrkhpevdvlinfaslrsaydstmetmnyaqirtiaiiaegipealt
    rklikkadqkgvtiigpatvggikpgcfkigntggmldnilasklyrpgsvayvsrsggm
    snelnniisrttdgvyegvaiggdrypgstfmdhvlryqdtpgvkmivvlgeiggteeyk
    icrgikegrltkpivcwcigtcatqasetavaknqalkeagvfvprsfdelgeiiqsvye
    dlvangvivpaqevpppt