PDB entry 3mwb

View 3mwb on RCSB PDB site
Description: the crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
Deposited on 2010-05-05, released 2010-06-30
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prephenate dehydratase
    Species: Arthrobacter aurescens [TaxId:290340]
    Gene: pheA, AAur_0101
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Prephenate dehydratase
    Species: Arthrobacter aurescens [TaxId:290340]
    Gene: pheA, AAur_0101
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PHE, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mwbA (A:)
    snamsavtytflgpqgtfteaalmqvpgaadatripctnvntalervrageadaamvpie
    nsveggvtatldaiatgqelriirealvpitfvlvarpgvelsdikristhghawaqcrl
    wvdehlpnadyvpgsstaasamglleddapyeaaicapliaaeqpglnvlaedigdnpda
    vtrfilvsrpgalpertgadkttvvvplpedhpgalmeildqfasrgvnlsriesrptgq
    ylghyffsidadghatdsrvadalaglhrispatrflgsyaradkqpavvaphtsdaafa
    sahawvdsilkgs
    

    Sequence, based on observed residues (ATOM records):
    >3mwbA (A:)
    vtytflgpqgtfteaalmqvpgaadatripctnvntalervrageadaamvpiensvegg
    vtatldaiatgqelriirealvpitfvlvarpgvelsdikristhghawaqcrlwvdehl
    pnadyvpgsstaasamglleddapyeaaicapliaaeqpglnvlaedigdnpdavtrfil
    vsrpgalpertgadkttvvvplpedhpgalmeildqfasrgvnlsriesrptgqylghyf
    fsidadghatdsrvadalaglhrispatrflgsyaradkqpavvaphtsdaafasahawv
    dsilkg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mwbB (B:)
    snamsavtytflgpqgtfteaalmqvpgaadatripctnvntalervrageadaamvpie
    nsveggvtatldaiatgqelriirealvpitfvlvarpgvelsdikristhghawaqcrl
    wvdehlpnadyvpgsstaasamglleddapyeaaicapliaaeqpglnvlaedigdnpda
    vtrfilvsrpgalpertgadkttvvvplpedhpgalmeildqfasrgvnlsriesrptgq
    ylghyffsidadghatdsrvadalaglhrispatrflgsyaradkqpavvaphtsdaafa
    sahawvdsilkgs
    

    Sequence, based on observed residues (ATOM records):
    >3mwbB (B:)
    vtytflgpqgtfteaalmqvpgaadatripctnvntalervrageadaamvpiensvegg
    vtatldaiatgqelriirealvpitfvlvarpgvelsdikristhghawaqcrlwvdehl
    pnadyvpgsstaasamglleddapyeaaicapliaaeqpglnvlaedigdnpdavtrfil
    vsrpgalpertgadkttvvvplpedhpgalmeildqfasrgvnlsriesrptlghyffsi
    dadghatdsrvadalaglhrispatrflgsyaradkqpavvaphtsdaafasahawvdsi
    lkg