PDB entry 3mw9

View 3mw9 on RCSB PDB site
Description: Bovine glutamate dehydrogenase complexed with NADH, GTP, glutamate
Class: oxidoreductase
Keywords: glutamate dehydrogenase, allostery, inhibition, OXIDOREDUCTASE
Deposited on 2010-05-05, released 2010-06-16
Made obsolete by 6dhm on 2018-07-25

The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate Dehydrogenase 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mw9a1, d3mw9a2
  • Chain 'B':
    Compound: Glutamate Dehydrogenase 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mw9b1, d3mw9b2
  • Chain 'C':
    Compound: Glutamate Dehydrogenase 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mw9c1, d3mw9c2
  • Chain 'D':
    Compound: Glutamate Dehydrogenase 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mw9d1, d3mw9d2
  • Chain 'E':
    Compound: Glutamate Dehydrogenase 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mw9e1, d3mw9e2
  • Chain 'F':
    Compound: Glutamate Dehydrogenase 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mw9f1, d3mw9f2
  • Heterogens: GLU, NAI, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mw9A (A:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mw9B (B:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mw9C (C:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mw9D (D:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mw9E (E:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mw9F (F:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfvvqgfgnvglhsmrylhrfgakcitvgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlnnlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft