PDB entry 3mw8

View 3mw8 on RCSB PDB site
Description: crystal structure of an uroporphyrinogen-iii synthase (sama_3255) from shewanella amazonensis sb2b at 1.65 a resolution
Deposited on 2010-05-05, released 2010-05-19
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uroporphyrinogen-III synthase
    Species: Shewanella amazonensis [TaxId:326297]
    Gene: Sama_3255
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1SAQ1 (1-239)
      • leader sequence (0)
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mw8A (A:)
    gmkllltrpegknaamasaldalaipylvepllsveaaavtqaqldelsradilifists
    avsfatpwlkdqwpkatyyavgdatadalalqgitaerspadsqateglltlpsleqvsg
    kqivivrgkggreamadglrlrganvsylevyqracppldapasvsrwqsfgidtivvts
    gevlenlinlvpkdsfawlrdchiivpsarvetqarkkglrrvtnagaanqaavldalgm
    

    Sequence, based on observed residues (ATOM records):
    >3mw8A (A:)
    gmkllltrpegknaamasaldalaipylvepllsveaaavtqaqldelsradilifists
    avsfatpwlkdqwpkatyyavgdatadalalqgitaerspqateglltlpsleqvsgkqi
    vivrgkggreamadglrlrganvsylevyqracppldapasvsrwqsfgidtivvtsgev
    lenlinlvpkdsfawlrdchiivpsarvetqarkkglrrvtnagaanqaavldalgm