PDB entry 3mw7

View 3mw7 on RCSB PDB site
Description: Crystal structure of human orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-UMP(produced from 5-fluoro-6-amino-UMP)
Deposited on 2010-05-05, released 2011-04-06
The last revision was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.208
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine 5'-monophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: gi|13960142, OK/SW-cl.21, UMPS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uridine 5'-monophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: gi|13960142, OK/SW-cl.21, UMPS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 5FU, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mw7A (A:)
    mgsshhhhhhssglvprgshmdaetvgrvkrfiqenvfvaanhngsplsikeapkelsfg
    araelprihpvaskllrlmqkketnlclsadvslarellqladalgpsicmlkthvdiln
    dftldvmkelitlakcheflifedrkfadigntvkkqyeggifkiaswadlvnahvvpgs
    gvvkglqevglplhrgclliaemsstgslatgdytraavrmaeehsefvvgfisgsrvsm
    kpeflhltpgvqleaggdnlgqqynspqevigkrgsdiiivgrgiisaadrleaaemyrk
    aaweaylsrlgv
    

    Sequence, based on observed residues (ATOM records):
    >3mw7A (A:)
    apkelsfgaraelprihpvaskllrlmqkketnlclsadvslarellqladalgpsicml
    kthvdilndftldvmkelitlakcheflifedrkfadigntvkkqyeggifkiaswadlv
    nahvvpgsgvvkglqevglplhrgclliaemsstgslatgdytraavrmaeehsefvvgf
    isgsrvsmkpeflhltpgvqleaggdnlgqqynspqevigkrgsdiiivgrgiisaadrl
    eaaemyrkaaweaylsrlg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mw7B (B:)
    mgsshhhhhhssglvprgshmdaetvgrvkrfiqenvfvaanhngsplsikeapkelsfg
    araelprihpvaskllrlmqkketnlclsadvslarellqladalgpsicmlkthvdiln
    dftldvmkelitlakcheflifedrkfadigntvkkqyeggifkiaswadlvnahvvpgs
    gvvkglqevglplhrgclliaemsstgslatgdytraavrmaeehsefvvgfisgsrvsm
    kpeflhltpgvqleaggdnlgqqynspqevigkrgsdiiivgrgiisaadrleaaemyrk
    aaweaylsrlgv
    

    Sequence, based on observed residues (ATOM records):
    >3mw7B (B:)
    elsfgaraelprihpvaskllrlmqkketnlclsadvslarellqladalgpsicmlkth
    vdilndftldvmkelitlakcheflifedrkfadigntvkkqyeggifkiaswadlvnah
    vvpgsgvvkglqevglplhrgclliaemsstgslatgdytraavrmaeehsefvvgfisg
    srvsmkpeflhltpgvqleaggdnlgqqynspqevigkrgsdiiivgrgiisaadrleaa
    emyrkaaweaylsrlg