PDB entry 3mw6

View 3mw6 on RCSB PDB site
Description: Crystal structure of NMB1681 from Neisseria meningitidis MC58, a FinO-like RNA chaperone
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PSI-2, PROTEIN STRUCTURE INITIATIVE, MIDWEST CENTER FOR STRUCTURAL GENOMICS, MCSG, unknown function
Deposited on 2010-05-05, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.193
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized protein NMB1681
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB1681
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mw6a_
  • Chain 'B':
    Compound: uncharacterized protein NMB1681
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB1681
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mw6b_
  • Chain 'C':
    Compound: uncharacterized protein NMB1681
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB1681
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mw6c_
  • Chain 'D':
    Compound: uncharacterized protein NMB1681
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB1681
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JY98 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3mw6d1, d3mw6d2
  • Chain 'E':
    Compound: uncharacterized protein NMB1681
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB1681
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JY98 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3mw6e1, d3mw6e2
  • Chain 'F':
    Compound: uncharacterized protein NMB1681
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB1681
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mw6f_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mw6A (A:)
    snamtqetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalp
    qydaaliarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqalq
    qqsaqaaaetlsveaeaaessaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mw6A (A:)
    qetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalpqydaa
    liarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqalqqqsaq
    aa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mw6B (B:)
    snamtqetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalp
    qydaaliarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqalq
    qqsaqaaaetlsveaeaaessaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mw6B (B:)
    kkkqtemiadhiygkydvfkrfkplalgidqdliaalpqydaaliarvlanhcrrprylk
    alarggkrfdlnnrfkgevtpeeqaiaqnhpfvq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mw6C (C:)
    snamtqetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalp
    qydaaliarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqalq
    qqsaqaaaetlsveaeaaessaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mw6C (C:)
    talgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalpqydaali
    arvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mw6D (D:)
    snamtqetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalp
    qydaaliarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqalq
    qqsaqaaaetlsveaeaaessaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mw6D (D:)
    amtqetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalpqy
    daaliarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqalq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mw6E (E:)
    snamtqetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalp
    qydaaliarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqalq
    qqsaqaaaetlsveaeaaessaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mw6E (E:)
    namtqetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalpq
    ydaaliarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqalq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mw6F (F:)
    snamtqetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalp
    qydaaliarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqalq
    qqsaqaaaetlsveaeaaessaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mw6F (F:)
    mtqetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalpqyd
    aaliarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqal