PDB entry 3mw4

View 3mw4 on RCSB PDB site
Description: Crystal structure of beta-neurexin 3 without the splice insert 4
Class: cell adhesion
Keywords: NEUREXIN, LNS domain, CALCIUM-binding, CELL ADHESION, GLYCOPROTEIN
Deposited on 2010-05-05, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurexin-2-beta
    Species: Mus musculus [TaxId:10090]
    Gene: C14orf60, KIAA0743, mKIAA0743, Nrxn3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZQ56 (4-177)
      • expression tag (0-3)
      • engineered (102)
    Domains in SCOPe 2.07: d3mw4a1, d3mw4a2
  • Chain 'B':
    Compound: Neurexin-2-beta
    Species: Mus musculus [TaxId:10090]
    Gene: C14orf60, KIAA0743, mKIAA0743, Nrxn3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZQ56 (4-177)
      • expression tag (0-3)
      • engineered (102)
    Domains in SCOPe 2.07: d3mw4b1, d3mw4b2
  • Chain 'C':
    Compound: Neurexin-2-beta
    Species: Mus musculus [TaxId:10090]
    Gene: C14orf60, KIAA0743, mKIAA0743, Nrxn3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZQ56 (4-177)
      • expression tag (0-3)
      • engineered (102)
    Domains in SCOPe 2.07: d3mw4c1, d3mw4c2
  • Heterogens: CA, NAG, BMA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mw4A (A:)
    gpgsatyifgksgglilytwpandrpstrsdrlavgfsttvkdgilvridsapglgdflq
    lhieqgkigvvfnigtvdisikeertpvndgkyhvvrftrnganatlqvdnwpvnehypt
    grqltifntqaqiaiggkdkgrlfqgqlsglyydglkvlnmaaennpnikingsvrlv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mw4B (B:)
    gpgsatyifgksgglilytwpandrpstrsdrlavgfsttvkdgilvridsapglgdflq
    lhieqgkigvvfnigtvdisikeertpvndgkyhvvrftrnganatlqvdnwpvnehypt
    grqltifntqaqiaiggkdkgrlfqgqlsglyydglkvlnmaaennpnikingsvrlv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mw4C (C:)
    gpgsatyifgksgglilytwpandrpstrsdrlavgfsttvkdgilvridsapglgdflq
    lhieqgkigvvfnigtvdisikeertpvndgkyhvvrftrnganatlqvdnwpvnehypt
    grqltifntqaqiaiggkdkgrlfqgqlsglyydglkvlnmaaennpnikingsvrlv