PDB entry 3mw2

View 3mw2 on RCSB PDB site
Description: Crystal structure of beta-neurexin 1 with the splice insert 4
Class: cell adhesion
Keywords: NEUREXIN, LNS domain, CALCIUM-binding, CELL ADHESION, GLYCOPROTEIN
Deposited on 2010-05-05, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurexin-1-alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Nrxn1, Kiaa0578
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CS84 (4-206)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d3mw2a1, d3mw2a2
  • Chain 'B':
    Compound: Neurexin-1-alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Nrxn1, Kiaa0578
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CS84 (4-206)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d3mw2b1, d3mw2b2
  • Heterogens: NAG, BMA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mw2A (A:)
    gpgstyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
    hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
    nndnerlaiarqripyrlgrvvdewlldkgrqltifnsqatiiiggkeqgqpfqgqlsgl
    yynglkvlnmaaendaniaivgnvrlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mw2A (A:)
    gstyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylelhi
    hqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierlaiarq
    ripyrlgrvvdewlldkgrqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaa
    endaniaivgnvrlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mw2B (B:)
    gpgstyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
    hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
    nndnerlaiarqripyrlgrvvdewlldkgrqltifnsqatiiiggkeqgqpfqgqlsgl
    yynglkvlnmaaendaniaivgnvrlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mw2B (B:)
    gstyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylelhi
    hqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvieryerlai
    arqripyrlgrvvdewlldkgrqltifnsqatiiiggkeqgqpfqgqlsglyynglkvln
    maaendaniaivgnvrlv